BLASTX nr result
ID: Ophiopogon27_contig00033364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00033364 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264605.1| putative serine carboxypeptidase-like 23 [As... 67 5e-10 >ref|XP_020264605.1| putative serine carboxypeptidase-like 23 [Asparagus officinalis] gb|ONK69543.1| uncharacterized protein A4U43_C05F24080 [Asparagus officinalis] Length = 485 Score = 66.6 bits (161), Expect = 5e-10 Identities = 37/76 (48%), Positives = 47/76 (61%) Frame = +1 Query: 205 MRTTFPTLLLLSCCIVAFNHANGYDREANHLQEFIQSQTLLKSIRQQSWNLLNSKNTITY 384 M+ F LLL A HAN EA+ L+E ++SQ L++SIR Q+W LLNSK Y Sbjct: 1 MKIVFLALLLF----FALQHANCSYNEADRLRELMKSQPLIQSIRNQAWKLLNSKKAPIY 56 Query: 385 TAAQVGLMEADKIDAL 432 Q G+MEADKID+L Sbjct: 57 VGPQDGMMEADKIDSL 72