BLASTX nr result
ID: Ophiopogon27_contig00033169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00033169 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258290.1| uncharacterized protein LOC109834670 [Aspara... 63 1e-08 gb|ONK74496.1| uncharacterized protein A4U43_C03F6970 [Asparagus... 63 1e-08 >ref|XP_020258290.1| uncharacterized protein LOC109834670 [Asparagus officinalis] Length = 1076 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 293 PGVDRKSENEISEAKRPLKAAAKTEKEKNMPLFLAPVIRKPVPNPS 156 P +RKSENEI E KR +K KTE+EK PL LAP I+KPVPNPS Sbjct: 674 PEGNRKSENEIPEEKRSIKVVTKTEEEKVFPLILAPTIKKPVPNPS 719 >gb|ONK74496.1| uncharacterized protein A4U43_C03F6970 [Asparagus officinalis] Length = 1149 Score = 62.8 bits (151), Expect = 1e-08 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 293 PGVDRKSENEISEAKRPLKAAAKTEKEKNMPLFLAPVIRKPVPNPS 156 P +RKSENEI E KR +K KTE+EK PL LAP I+KPVPNPS Sbjct: 674 PEGNRKSENEIPEEKRSIKVVTKTEEEKVFPLILAPTIKKPVPNPS 719