BLASTX nr result
ID: Ophiopogon27_contig00033155
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00033155 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010070309.1| PREDICTED: exosome complex component RRP4 ho... 73 8e-14 ref|XP_009381496.1| PREDICTED: exosome complex component RRP4 ho... 75 2e-13 ref|XP_008780046.2| PREDICTED: exosome complex component RRP4 ho... 72 2e-13 gb|PON52880.1| Exosome complex RNA-binding protein 1/RRP40/RRP [... 75 2e-13 ref|XP_010070311.1| PREDICTED: exosome complex component RRP4 ho... 71 2e-13 gb|KMZ58605.1| Exosome complex exonuclease RRP4 [Zostera marina] 75 3e-13 ref|XP_020085095.1| exosome complex component RRP4 homolog [Anan... 74 4e-13 gb|OAY82659.1| Exosome complex component rrp4 [Ananas comosus] 74 4e-13 ref|XP_022155678.1| exosome complex component RRP4 homolog isofo... 74 4e-13 ref|XP_021906851.1| exosome complex component RRP4 homolog [Cari... 74 4e-13 ref|XP_023738446.1| exosome complex component RRP4 homolog isofo... 74 4e-13 ref|XP_022155677.1| exosome complex component RRP4 homolog isofo... 74 4e-13 gb|KRH04717.1| hypothetical protein GLYMA_17G181200 [Glycine max] 69 5e-13 ref|XP_022931250.1| exosome complex component RRP4 homolog [Cucu... 74 5e-13 ref|XP_021833477.1| exosome complex component RRP4 homolog [Prun... 74 5e-13 ref|XP_008234924.1| PREDICTED: exosome complex component RRP4 ho... 74 5e-13 ref|XP_007200401.1| exosome complex component RRP4 homolog [Prun... 74 5e-13 ref|XP_023554062.1| exosome complex component RRP4 homolog [Cucu... 74 5e-13 ref|XP_023533481.1| exosome complex component RRP4 homolog [Cucu... 74 5e-13 ref|XP_022995373.1| exosome complex component RRP4 homolog [Cucu... 74 5e-13 >ref|XP_010070309.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Eucalyptus grandis] ref|XP_010070310.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Eucalyptus grandis] ref|XP_018716785.1| PREDICTED: exosome complex component RRP4 homolog isoform X1 [Eucalyptus grandis] Length = 134 Score = 72.8 bits (177), Expect = 8e-14 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 EVVATVCGVVERVNKLVYV+ RARYKPEV DIIVGRV+EV+ Sbjct: 62 EVVATVCGVVERVNKLVYVRTLRARYKPEVGDIIVGRVIEVA 103 >ref|XP_009381496.1| PREDICTED: exosome complex component RRP4 homolog [Musa acuminata subsp. malaccensis] Length = 331 Score = 75.5 bits (184), Expect = 2e-13 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 EVVAT+CGVVERVNKLVYV+AQRARYKPEV DIIVGRV+E++ Sbjct: 64 EVVATLCGVVERVNKLVYVRAQRARYKPEVGDIIVGRVIEIA 105 >ref|XP_008780046.2| PREDICTED: exosome complex component RRP4 homolog, partial [Phoenix dactylifera] Length = 119 Score = 71.6 bits (174), Expect = 2e-13 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 +VVAT+CGVVERVNKLVYV+A RARYKPEV DIIVGRV+E++ Sbjct: 50 QVVATLCGVVERVNKLVYVRALRARYKPEVGDIIVGRVIEIA 91 >gb|PON52880.1| Exosome complex RNA-binding protein 1/RRP40/RRP [Trema orientalis] Length = 333 Score = 75.1 bits (183), Expect = 2e-13 Identities = 40/59 (67%), Positives = 47/59 (79%), Gaps = 3/59 (5%) Frame = -2 Query: 375 LNYTTNRGHHFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 L YT+ H T + E+VATVCG+VERVNKLVYV+A RARYKPEV DIIVGRV+EV+ Sbjct: 51 LKYTSRLLGHGTSELNGEIVATVCGIVERVNKLVYVRALRARYKPEVGDIIVGRVVEVA 109 >ref|XP_010070311.1| PREDICTED: exosome complex component RRP4 homolog isoform X2 [Eucalyptus grandis] Length = 106 Score = 70.9 bits (172), Expect = 2e-13 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLE 214 EVVATVCGVVERVNKLVYV+ RARYKPEV DIIVGRV+E Sbjct: 62 EVVATVCGVVERVNKLVYVRTLRARYKPEVGDIIVGRVIE 101 >gb|KMZ58605.1| Exosome complex exonuclease RRP4 [Zostera marina] Length = 379 Score = 75.1 bits (183), Expect = 3e-13 Identities = 40/54 (74%), Positives = 44/54 (81%) Frame = -2 Query: 366 TTNRGHHFTIDEVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVSS 205 TTNR D+VVATVCG+VERVNKLVYV+ RARYKPEV DIIVGRV+EV S Sbjct: 112 TTNRN-----DDVVATVCGIVERVNKLVYVRDLRARYKPEVGDIIVGRVIEVVS 160 >ref|XP_020085095.1| exosome complex component RRP4 homolog [Ananas comosus] Length = 322 Score = 74.3 bits (181), Expect = 4e-13 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T+D EVVAT+CGVVERVNKLVYV+A RARYKPEV DIIVGRV+E++ Sbjct: 56 HGTLDCDGEVVATLCGVVERVNKLVYVRALRARYKPEVGDIIVGRVIEIA 105 >gb|OAY82659.1| Exosome complex component rrp4 [Ananas comosus] Length = 325 Score = 74.3 bits (181), Expect = 4e-13 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T+D EVVAT+CGVVERVNKLVYV+A RARYKPEV DIIVGRV+E++ Sbjct: 59 HGTLDCDGEVVATLCGVVERVNKLVYVRALRARYKPEVGDIIVGRVIEIA 108 >ref|XP_022155678.1| exosome complex component RRP4 homolog isoform X2 [Momordica charantia] ref|XP_022155679.1| exosome complex component RRP4 homolog isoform X2 [Momordica charantia] ref|XP_022155680.1| exosome complex component RRP4 homolog isoform X2 [Momordica charantia] ref|XP_022155681.1| exosome complex component RRP4 homolog isoform X2 [Momordica charantia] Length = 328 Score = 74.3 bits (181), Expect = 4e-13 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T D EVVATVCGVVERVNKL+YV+A RARYKPEV DI+VGRV+EV+ Sbjct: 54 HGTFDLHGEVVATVCGVVERVNKLIYVRALRARYKPEVGDIVVGRVMEVA 103 >ref|XP_021906851.1| exosome complex component RRP4 homolog [Carica papaya] Length = 329 Score = 74.3 bits (181), Expect = 4e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 EVVATVCGVVERVNKLVYV+A RARYKPEV DI+VGRVLE++ Sbjct: 62 EVVATVCGVVERVNKLVYVRALRARYKPEVGDIVVGRVLEIA 103 >ref|XP_023738446.1| exosome complex component RRP4 homolog isoform X1 [Lactuca sativa] Length = 332 Score = 74.3 bits (181), Expect = 4e-13 Identities = 40/52 (76%), Positives = 43/52 (82%), Gaps = 2/52 (3%) Frame = -2 Query: 357 RGHHFTI--DEVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 RGH T EVVATVCGV+ERVNKLVYV+ RARYKPEV DIIVGRVLEV+ Sbjct: 59 RGHGTTELEGEVVATVCGVIERVNKLVYVRTLRARYKPEVGDIIVGRVLEVA 110 >ref|XP_022155677.1| exosome complex component RRP4 homolog isoform X1 [Momordica charantia] Length = 341 Score = 74.3 bits (181), Expect = 4e-13 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T D EVVATVCGVVERVNKL+YV+A RARYKPEV DI+VGRV+EV+ Sbjct: 67 HGTFDLHGEVVATVCGVVERVNKLIYVRALRARYKPEVGDIVVGRVMEVA 116 >gb|KRH04717.1| hypothetical protein GLYMA_17G181200 [Glycine max] Length = 85 Score = 69.3 bits (168), Expect = 5e-13 Identities = 35/59 (59%), Positives = 47/59 (79%), Gaps = 3/59 (5%) Frame = -2 Query: 375 LNYTTNRGHHFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 ++Y +GH T D EVVAT+CGVVE +NKLVYV+A R++YKPEV DI++GRV+EV+ Sbjct: 1 MSYGVLKGHE-TADLNGEVVATLCGVVEHINKLVYVRALRSKYKPEVGDIVIGRVVEVA 58 >ref|XP_022931250.1| exosome complex component RRP4 homolog [Cucurbita moschata] ref|XP_022931251.1| exosome complex component RRP4 homolog [Cucurbita moschata] ref|XP_022931253.1| exosome complex component RRP4 homolog [Cucurbita moschata] Length = 326 Score = 73.9 bits (180), Expect = 5e-13 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T+D EVVAT+CGVVERVNKL+YV+A RARYKPEV DIIVGRV EV+ Sbjct: 54 HGTLDLNGEVVATICGVVERVNKLIYVRALRARYKPEVGDIIVGRVTEVA 103 >ref|XP_021833477.1| exosome complex component RRP4 homolog [Prunus avium] Length = 326 Score = 73.9 bits (180), Expect = 5e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 EVVATVCG+VERVNKLVYV+A RARYKPEV DIIVGRV+EV+ Sbjct: 62 EVVATVCGIVERVNKLVYVRALRARYKPEVGDIIVGRVIEVA 103 >ref|XP_008234924.1| PREDICTED: exosome complex component RRP4 homolog [Prunus mume] Length = 326 Score = 73.9 bits (180), Expect = 5e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 EVVATVCG+VERVNKLVYV+A RARYKPEV DIIVGRV+EV+ Sbjct: 62 EVVATVCGIVERVNKLVYVRALRARYKPEVGDIIVGRVIEVA 103 >ref|XP_007200401.1| exosome complex component RRP4 homolog [Prunus persica] gb|ONH93692.1| hypothetical protein PRUPE_8G247600 [Prunus persica] Length = 326 Score = 73.9 bits (180), Expect = 5e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -2 Query: 333 EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 EVVATVCG+VERVNKLVYV+A RARYKPEV DIIVGRV+EV+ Sbjct: 62 EVVATVCGIVERVNKLVYVRALRARYKPEVGDIIVGRVIEVA 103 >ref|XP_023554062.1| exosome complex component RRP4 homolog [Cucurbita pepo subsp. pepo] ref|XP_023554063.1| exosome complex component RRP4 homolog [Cucurbita pepo subsp. pepo] ref|XP_023554064.1| exosome complex component RRP4 homolog [Cucurbita pepo subsp. pepo] Length = 327 Score = 73.9 bits (180), Expect = 5e-13 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T+D EVVAT+CGVVERVNKL+YV+A RARYKPEV DIIVGRV EV+ Sbjct: 54 HGTLDLNGEVVATICGVVERVNKLIYVRALRARYKPEVGDIIVGRVTEVA 103 >ref|XP_023533481.1| exosome complex component RRP4 homolog [Cucurbita pepo subsp. pepo] ref|XP_023533482.1| exosome complex component RRP4 homolog [Cucurbita pepo subsp. pepo] Length = 327 Score = 73.9 bits (180), Expect = 5e-13 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T+D EVVAT+CGVVERVNKL+YV+A RARYKPEV DIIVGRV EV+ Sbjct: 54 HGTLDLNGEVVATICGVVERVNKLIYVRALRARYKPEVGDIIVGRVTEVA 103 >ref|XP_022995373.1| exosome complex component RRP4 homolog [Cucurbita maxima] ref|XP_022995374.1| exosome complex component RRP4 homolog [Cucurbita maxima] ref|XP_022995375.1| exosome complex component RRP4 homolog [Cucurbita maxima] ref|XP_022995376.1| exosome complex component RRP4 homolog [Cucurbita maxima] Length = 327 Score = 73.9 bits (180), Expect = 5e-13 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 3/50 (6%) Frame = -2 Query: 348 HFTID---EVVATVCGVVERVNKLVYVQAQRARYKPEVRDIIVGRVLEVS 208 H T+D EVVAT+CGVVERVNKL+YV+A RARYKPEV DIIVGRV EV+ Sbjct: 54 HGTLDLYGEVVATICGVVERVNKLIYVRALRARYKPEVGDIIVGRVTEVA 103