BLASTX nr result
ID: Ophiopogon27_contig00033027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00033027 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020264672.1| uncharacterized protein LOC109840435 [Aspara... 59 1e-07 >ref|XP_020264672.1| uncharacterized protein LOC109840435 [Asparagus officinalis] gb|ONK67787.1| uncharacterized protein A4U43_C05F3770 [Asparagus officinalis] Length = 966 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 268 DLVEAVRAQREGAVQLRKQTNLSKIPLDFTPGNEVPIEEDS 390 ++V RAQREG VQLRKQTNLSKI LDF PG+ VPI+E++ Sbjct: 27 NIVAVERAQREGNVQLRKQTNLSKIALDFAPGSRVPIDEEN 67