BLASTX nr result
ID: Ophiopogon27_contig00032988
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032988 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Ph... 47 4e-06 >ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera] ref|XP_008799466.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera] Length = 747 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -1 Query: 263 RYVSSH*ITTVERRKERARATAQEFLLDLKNGVLDL 156 +Y ++ +T +ERR ERAR+TA+EFLLDL++G LDL Sbjct: 253 KYHPTNLVTVIERRNERARSTAKEFLLDLQSGTLDL 288 Score = 31.2 bits (69), Expect(2) = 4e-06 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 Query: 289 TQKDE*WLQDMYHPTKL 239 T KDE WL+D YHPT L Sbjct: 243 THKDEEWLKDKYHPTNL 259