BLASTX nr result
ID: Ophiopogon27_contig00032913
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032913 (349 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK71855.1| uncharacterized protein A4U43_C04F13080 [Asparagu... 73 1e-13 ref|XP_020273108.1| endoplasmic reticulum oxidoreductin-1-like [... 73 1e-12 gb|ONK64411.1| uncharacterized protein A4U43_C07F25620 [Asparagu... 73 1e-12 gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spina... 72 2e-12 ref|XP_020686747.1| endoplasmic reticulum oxidoreductin-1-like [... 70 2e-11 gb|KMS98074.1| hypothetical protein BVRB_4g095870 [Beta vulgaris... 69 4e-11 ref|XP_010694837.1| PREDICTED: endoplasmic reticulum oxidoreduct... 69 5e-11 gb|KNA06490.1| hypothetical protein SOVF_180620 isoform A [Spina... 67 1e-10 ref|XP_021866898.1| endoplasmic reticulum oxidoreductin-1 [Spina... 67 1e-10 ref|XP_008794025.1| PREDICTED: endoplasmic reticulum oxidoreduct... 67 2e-10 ref|XP_020587405.1| endoplasmic reticulum oxidoreductin-1 [Phala... 67 2e-10 ref|XP_010932625.1| PREDICTED: endoplasmic reticulum oxidoreduct... 66 4e-10 ref|XP_015690057.1| PREDICTED: endoplasmic reticulum oxidoreduct... 65 5e-10 ref|XP_019159165.1| PREDICTED: endoplasmic reticulum oxidoreduct... 65 7e-10 ref|XP_019159164.1| PREDICTED: endoplasmic reticulum oxidoreduct... 65 7e-10 ref|XP_019159163.1| PREDICTED: endoplasmic reticulum oxidoreduct... 65 8e-10 ref|XP_015888362.1| PREDICTED: endoplasmic reticulum oxidoreduct... 64 2e-09 ref|XP_016447449.1| PREDICTED: endoplasmic reticulum oxidoreduct... 60 2e-09 emb|CDP06120.1| unnamed protein product [Coffea canephora] 64 3e-09 ref|XP_020588553.1| endoplasmic reticulum oxidoreductin-1-like i... 63 5e-09 >gb|ONK71855.1| uncharacterized protein A4U43_C04F13080 [Asparagus officinalis] Length = 165 Score = 72.8 bits (177), Expect = 1e-13 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 179 NGQ NQPL+LQRNEVIA LNLLNRLSES+ FVRKM P DK M GQ PA +V Sbjct: 107 NGQSTKNQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSV 163 >ref|XP_020273108.1| endoplasmic reticulum oxidoreductin-1-like [Asparagus officinalis] Length = 342 Score = 72.8 bits (177), Expect = 1e-12 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 179 NGQ NQPL+LQRNEVIA LNLLNRLSES+ FVRKM P DK M GQ PA +V Sbjct: 284 NGQSTKNQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSV 340 >gb|ONK64411.1| uncharacterized protein A4U43_C07F25620 [Asparagus officinalis] Length = 489 Score = 72.8 bits (177), Expect = 1e-12 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 179 NGQ NQPL+LQRNEVIA LNLLNRLSES+ FVRKM P DK M GQ PA +V Sbjct: 431 NGQSTKNQPLQLQRNEVIAFLNLLNRLSESVDFVRKMAPQFDKFME--GQHYHPAGGSV 487 >gb|KNA06491.1| hypothetical protein SOVF_180620 isoform B [Spinacia oleracea] Length = 358 Score = 72.4 bits (176), Expect = 2e-12 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = +3 Query: 6 GQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFS 185 G NQPL+LQRNEVIALLNLLNRLSES+ V +M P +DKI+ GQ S P S+ V + Sbjct: 285 GNNHLNQPLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQKVGT 341 Query: 186 IAKTWNS 206 + + W S Sbjct: 342 LQRIWQS 348 >ref|XP_020686747.1| endoplasmic reticulum oxidoreductin-1-like [Dendrobium catenatum] gb|PKU64309.1| Endoplasmic oxidoreductin-1 [Dendrobium catenatum] Length = 452 Score = 69.7 bits (169), Expect = 2e-11 Identities = 38/58 (65%), Positives = 45/58 (77%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKT 176 NGQ NQPL+LQRNEVIAL+NLLNRLSES++FVR+M P + IM + SSPA KT Sbjct: 395 NGQNHLNQPLQLQRNEVIALVNLLNRLSESVNFVREMGPSAENIME--RRPSSPARKT 450 >gb|KMS98074.1| hypothetical protein BVRB_4g095870 [Beta vulgaris subsp. vulgaris] Length = 444 Score = 68.6 bits (166), Expect = 4e-11 Identities = 36/67 (53%), Positives = 46/67 (68%) Frame = +3 Query: 6 GQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFS 185 G NQPL+LQRNEVIAL+NLLNRLSES+ V +M P DKI+ GQ + P S+ V + Sbjct: 371 GDNHFNQPLQLQRNEVIALINLLNRLSESVKLVHEMAPSADKIV---GQVAGPPSQEVST 427 Query: 186 IAKTWNS 206 + + W S Sbjct: 428 MRRIWQS 434 >ref|XP_010694837.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Beta vulgaris subsp. vulgaris] Length = 466 Score = 68.6 bits (166), Expect = 5e-11 Identities = 36/67 (53%), Positives = 46/67 (68%) Frame = +3 Query: 6 GQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVFS 185 G NQPL+LQRNEVIAL+NLLNRLSES+ V +M P DKI+ GQ + P S+ V + Sbjct: 393 GDNHFNQPLQLQRNEVIALINLLNRLSESVKLVHEMAPSADKIV---GQVAGPPSQEVST 449 Query: 186 IAKTWNS 206 + + W S Sbjct: 450 MRRIWQS 456 >gb|KNA06490.1| hypothetical protein SOVF_180620 isoform A [Spinacia oleracea] Length = 360 Score = 67.4 bits (163), Expect = 1e-10 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = +3 Query: 6 GQGLTNQPLKLQ--RNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 179 G NQPL+LQ RNEVIALLNLLNRLSES+ V +M P +DKI+ GQ S P S+ V Sbjct: 285 GNNHLNQPLQLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQKV 341 Query: 180 FSIAKTWNS 206 ++ + W S Sbjct: 342 GTLQRIWQS 350 >ref|XP_021866898.1| endoplasmic reticulum oxidoreductin-1 [Spinacia oleracea] Length = 468 Score = 67.4 bits (163), Expect = 1e-10 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 2/69 (2%) Frame = +3 Query: 6 GQGLTNQPLKLQ--RNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTV 179 G NQPL+LQ RNEVIALLNLLNRLSES+ V +M P +DKI+ GQ S P S+ V Sbjct: 393 GDNHLNQPLQLQLQRNEVIALLNLLNRLSESVKLVHEMAPSVDKIV---GQVSGPPSQKV 449 Query: 180 FSIAKTWNS 206 ++ + W S Sbjct: 450 GTLQRIWQS 458 >ref|XP_008794025.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Phoenix dactylifera] Length = 454 Score = 67.0 bits (162), Expect = 2e-10 Identities = 37/58 (63%), Positives = 43/58 (74%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKT 176 NGQ L NQ L+LQRNEVIAL+NLLNRLSES+ V +M P I+KIM GQ S P K+ Sbjct: 397 NGQNLMNQHLQLQRNEVIALVNLLNRLSESVKLVHEMGPSIEKIME--GQFSPPTRKS 452 >ref|XP_020587405.1| endoplasmic reticulum oxidoreductin-1 [Phalaenopsis equestris] ref|XP_020587406.1| endoplasmic reticulum oxidoreductin-1 [Phalaenopsis equestris] Length = 448 Score = 66.6 bits (161), Expect = 2e-10 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASK 173 NGQ NQPL+LQRNEVIAL+NLLNRLSES++FV +M P + IM + SSPA K Sbjct: 391 NGQNHANQPLQLQRNEVIALVNLLNRLSESVNFVHQMGPAAENIME--RRSSSPARK 445 >ref|XP_010932625.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Elaeis guineensis] Length = 455 Score = 65.9 bits (159), Expect = 4e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIM 137 NGQ L +QPL+LQRNEVIAL+NLLNRLSES+ V +MVP I+K M Sbjct: 398 NGQNLMSQPLQLQRNEVIALVNLLNRLSESVKLVHEMVPSIEKTM 442 >ref|XP_015690057.1| PREDICTED: endoplasmic reticulum oxidoreductin-1, partial [Oryza brachyantha] Length = 429 Score = 65.5 bits (158), Expect = 5e-10 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVF 182 NG NQPL+LQRNEVIAL+NLLNRLSES++FV + P I++++ Q SSP K VF Sbjct: 371 NGDNHLNQPLQLQRNEVIALVNLLNRLSESVNFVHEKGPSIEEVIK---QQSSPTVKPVF 427 >ref|XP_019159165.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X3 [Ipomoea nil] ref|XP_019159166.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X4 [Ipomoea nil] Length = 464 Score = 65.1 bits (157), Expect = 7e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAG 143 +GQ QPL+LQRNEVIAL+NLLNRLSESI FVR+M P I+K+M G Sbjct: 388 DGQKHPLQPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_019159164.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X2 [Ipomoea nil] Length = 479 Score = 65.1 bits (157), Expect = 7e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAG 143 +GQ QPL+LQRNEVIAL+NLLNRLSESI FVR+M P I+K+M G Sbjct: 388 DGQKHPLQPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_019159163.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like isoform X1 [Ipomoea nil] Length = 490 Score = 65.1 bits (157), Expect = 8e-10 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAG 143 +GQ QPL+LQRNEVIAL+NLLNRLSESI FVR+M P I+K+M G Sbjct: 388 DGQKHPLQPLQLQRNEVIALMNLLNRLSESISFVREMSPDIEKVMEG 434 >ref|XP_015888362.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Ziziphus jujuba] Length = 481 Score = 63.9 bits (154), Expect = 2e-09 Identities = 34/68 (50%), Positives = 46/68 (67%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVF 182 +G +QP++LQRNEVIALLNLLNRLSES+ V + P I+KI+ GG PA++ + Sbjct: 406 DGHNHPDQPVQLQRNEVIALLNLLNRLSESVKLVHEKGPSIEKILEGG--IVEPAAQKIT 463 Query: 183 SIAKTWNS 206 +TW S Sbjct: 464 KWLRTWKS 471 >ref|XP_016447449.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Nicotiana tabacum] Length = 101 Score = 60.1 bits (144), Expect = 2e-09 Identities = 33/68 (48%), Positives = 46/68 (67%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVF 182 +G+ +Q L+LQRNEVIAL+NLLNRLSESI V++M P +K + GG PA+K + Sbjct: 31 DGEYRHDQHLQLQRNEVIALVNLLNRLSESIKLVQEMSPTFEKTI--GGLSLQPAAKLIS 88 Query: 183 SIAKTWNS 206 S + W + Sbjct: 89 SWKRLWET 96 >emb|CDP06120.1| unnamed protein product [Coffea canephora] Length = 473 Score = 63.5 bits (153), Expect = 3e-09 Identities = 35/68 (51%), Positives = 47/68 (69%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVF 182 +G +NQPL+LQRNEVIAL+NLLNRLSESI FV+++ P I+K M G S P ++ Sbjct: 397 DGHSQSNQPLQLQRNEVIALVNLLNRLSESIKFVQEVSPSIEKKM--DGLLSEPIAEEFS 454 Query: 183 SIAKTWNS 206 S + W + Sbjct: 455 SWRRIWEA 462 >ref|XP_020588553.1| endoplasmic reticulum oxidoreductin-1-like isoform X1 [Phalaenopsis equestris] Length = 465 Score = 62.8 bits (151), Expect = 5e-09 Identities = 34/70 (48%), Positives = 43/70 (61%) Frame = +3 Query: 3 NGQGLTNQPLKLQRNEVIALLNLLNRLSESIHFVRKMVPHIDKIMAGGGQGSSPASKTVF 182 NGQ NQ L+LQRNEVIAL+NLLNRLSES++F+ +M P + IM + T Sbjct: 395 NGQNHANQLLQLQRNEVIALINLLNRLSESVNFIHEMGPSAENIMKRRPSSQARLIDTDC 454 Query: 183 SIAKTWNS*F 212 I+ W S F Sbjct: 455 LISSCWKSEF 464