BLASTX nr result
ID: Ophiopogon27_contig00032603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032603 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010929341.1| PREDICTED: transcription factor bHLH35 isofo... 54 9e-06 >ref|XP_010929341.1| PREDICTED: transcription factor bHLH35 isoform X3 [Elaeis guineensis] Length = 248 Score = 53.5 bits (127), Expect = 9e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -1 Query: 393 HTVFVEADEIGSIQLKKKIEAAIAEYDNMTSPTSSMSY 280 HT+FVE DE+GS QLK KI+ AIAE D SP SSMSY Sbjct: 211 HTLFVETDEMGSAQLKMKIQGAIAELDGSRSPGSSMSY 248