BLASTX nr result
ID: Ophiopogon27_contig00032548
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032548 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA64763.1| ribosomal RNA methyltransferase Nop2 [Apostasia s... 56 1e-06 ref|XP_020262026.1| tubulin-folding cofactor B [Asparagus offici... 52 7e-06 ref|XP_010276589.1| PREDICTED: tubulin-folding cofactor B [Nelum... 52 7e-06 ref|XP_012836903.1| PREDICTED: tubulin-folding cofactor B [Eryth... 52 9e-06 >gb|PKA64763.1| ribosomal RNA methyltransferase Nop2 [Apostasia shenzhenica] Length = 242 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 100 GEEAVVKLVGKAETVRPGYWVGI*LDEPLGKHD 2 G+ VVK VGKAE V PG+W+G+ LDEPLGKHD Sbjct: 170 GKRGVVKFVGKAEAVAPGFWIGVQLDEPLGKHD 202 >ref|XP_020262026.1| tubulin-folding cofactor B [Asparagus officinalis] gb|ONK73236.1| uncharacterized protein A4U43_C04F28760 [Asparagus officinalis] Length = 242 Score = 52.0 bits (123), Expect(2) = 7e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 97 EEAVVKLVGKAETVRPGYWVGI*LDEPLGKHD 2 + VVK VG+AET+ PG WVGI LDEPLGKHD Sbjct: 171 KRGVVKFVGRAETLAPGCWVGIQLDEPLGKHD 202 Score = 25.4 bits (54), Expect(2) = 7e-06 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 138 RLQFDHRCKVEPGEKR 91 +++ RC+VEPGEKR Sbjct: 157 KIKVGDRCEVEPGEKR 172 >ref|XP_010276589.1| PREDICTED: tubulin-folding cofactor B [Nelumbo nucifera] Length = 242 Score = 52.0 bits (123), Expect(2) = 7e-06 Identities = 22/32 (68%), Positives = 25/32 (78%) Frame = -2 Query: 97 EEAVVKLVGKAETVRPGYWVGI*LDEPLGKHD 2 + VVK VGKAE + PG+WVGI DEPLGKHD Sbjct: 171 KRGVVKFVGKAENIAPGFWVGIQYDEPLGKHD 202 Score = 25.4 bits (54), Expect(2) = 7e-06 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 138 RLQFDHRCKVEPGEKR 91 +++ RC+VEPGEKR Sbjct: 157 KIKVGDRCEVEPGEKR 172 >ref|XP_012836903.1| PREDICTED: tubulin-folding cofactor B [Erythranthe guttata] gb|EYU37628.1| hypothetical protein MIMGU_mgv1a012750mg [Erythranthe guttata] Length = 241 Score = 52.0 bits (123), Expect(2) = 9e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -2 Query: 97 EEAVVKLVGKAETVRPGYWVGI*LDEPLGKHD 2 + VVK VG+AET+ PG+WVGI DEPLGKHD Sbjct: 170 KRGVVKFVGRAETLAPGFWVGIQYDEPLGKHD 201 Score = 25.0 bits (53), Expect(2) = 9e-06 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 Query: 135 LQFDHRCKVEPGEKR 91 ++ RC+VEPGEKR Sbjct: 157 IRVGERCQVEPGEKR 171