BLASTX nr result
ID: Ophiopogon27_contig00032516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032516 (745 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020251894.1| probable inactive leucine-rich repeat recept... 86 2e-15 gb|ONK81525.1| uncharacterized protein A4U43_C01F30130 [Asparagu... 86 2e-15 gb|KCW83179.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus g... 58 5e-06 ref|XP_010026665.1| PREDICTED: probable inactive leucine-rich re... 58 5e-06 ref|XP_010026660.1| PREDICTED: probable inactive leucine-rich re... 58 5e-06 gb|KCW83177.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus g... 58 5e-06 ref|XP_010026641.1| PREDICTED: probable inactive leucine-rich re... 58 5e-06 gb|KCW83178.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus g... 58 5e-06 ref|XP_018721715.1| PREDICTED: probable inactive leucine-rich re... 58 5e-06 gb|PKI53300.1| hypothetical protein CRG98_026328 [Punica granatum] 57 9e-06 >ref|XP_020251894.1| probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Asparagus officinalis] ref|XP_020251895.1| probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Asparagus officinalis] ref|XP_020251896.1| probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Asparagus officinalis] Length = 773 Score = 85.9 bits (211), Expect = 2e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKVV 743 RKQLEYP+QLEAWNDTHLDFC+ PTSPFLM+TCE +SVTELK+V Sbjct: 36 RKQLEYPRQLEAWNDTHLDFCSAPTSPFLMITCEGNSVTELKIV 79 >gb|ONK81525.1| uncharacterized protein A4U43_C01F30130 [Asparagus officinalis] Length = 865 Score = 85.9 bits (211), Expect = 2e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKVV 743 RKQLEYP+QLEAWNDTHLDFC+ PTSPFLM+TCE +SVTELK+V Sbjct: 36 RKQLEYPRQLEAWNDTHLDFCSAPTSPFLMITCEGNSVTELKIV 79 >gb|KCW83179.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus grandis] gb|KCW83180.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus grandis] Length = 642 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 21 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 63 >ref|XP_010026665.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 isoform X4 [Eucalyptus grandis] Length = 659 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 38 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 80 >ref|XP_010026660.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 isoform X3 [Eucalyptus grandis] Length = 660 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 38 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 80 >gb|KCW83177.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus grandis] Length = 747 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 21 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 63 >ref|XP_010026641.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 isoform X2 [Eucalyptus grandis] Length = 764 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 38 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 80 >gb|KCW83178.1| hypothetical protein EUGRSUZ_B00130 [Eucalyptus grandis] Length = 775 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 21 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 63 >ref|XP_018721715.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 isoform X1 [Eucalyptus grandis] Length = 792 Score = 58.2 bits (139), Expect = 5e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKV 740 RKQLEYP QLE WN +DFC++P SP + TCE + +TELK+ Sbjct: 38 RKQLEYPPQLEIWNVHGVDFCSLPPSPTVNTTCENNFITELKL 80 >gb|PKI53300.1| hypothetical protein CRG98_026328 [Punica granatum] Length = 749 Score = 57.4 bits (137), Expect = 9e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +3 Query: 612 RKQLEYPKQLEAWNDTHLDFCAIPTSPFLMLTCEEDSVTELKVV 743 RK LEYP QLE W LD C +P SP + LTCE++SVTEL++V Sbjct: 28 RKHLEYPSQLEMWTTHGLDLCFLPPSPNVNLTCEKNSVTELQLV 71