BLASTX nr result
ID: Ophiopogon27_contig00032111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032111 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK55768.1| uncharacterized protein A4U43_C10F790 [Asparagus ... 55 3e-06 ref|XP_020247837.1| uncharacterized protein LOC109825393 [Aspara... 55 3e-06 >gb|ONK55768.1| uncharacterized protein A4U43_C10F790 [Asparagus officinalis] Length = 705 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 366 SRKSRSQQKHDGTRKLQVEDEIVDLARLFKARVFTFLESN 247 SRKS+S K T K+Q+E+E+VDLAR+FKARVFTFL N Sbjct: 665 SRKSQSHWKRHATNKMQLEEELVDLARMFKARVFTFLGQN 704 >ref|XP_020247837.1| uncharacterized protein LOC109825393 [Asparagus officinalis] Length = 777 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -1 Query: 366 SRKSRSQQKHDGTRKLQVEDEIVDLARLFKARVFTFLESN 247 SRKS+S K T K+Q+E+E+VDLAR+FKARVFTFL N Sbjct: 737 SRKSQSHWKRHATNKMQLEEELVDLARMFKARVFTFLGQN 776