BLASTX nr result
ID: Ophiopogon27_contig00032086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00032086 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81521.1| uncharacterized protein A4U43_C01F30080 [Asparagu... 65 3e-10 >gb|ONK81521.1| uncharacterized protein A4U43_C01F30080 [Asparagus officinalis] Length = 175 Score = 65.5 bits (158), Expect = 3e-10 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = +1 Query: 52 WCGSVEEEVLLGWFPWTAGPVHGXXXXXXXGDFDIWQLQQIHEIPGTAK 198 WCGS+EE++LLGWFPWT G + DFDIWQLQQI+EIP +K Sbjct: 71 WCGSIEEDLLLGWFPWT-GALMEEEEEGEERDFDIWQLQQINEIPNGSK 118