BLASTX nr result
ID: Ophiopogon27_contig00031874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031874 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245954.1| mediator-associated protein 2 [Asparagus off... 67 9e-11 >ref|XP_020245954.1| mediator-associated protein 2 [Asparagus officinalis] gb|ONK58635.1| uncharacterized protein A4U43_C09F15080 [Asparagus officinalis] Length = 219 Score = 67.4 bits (163), Expect = 9e-11 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -1 Query: 435 ETPKPSKKKKYDDHRSAEGSSHGSRPVSHVTDTSAASERSHGDKPMXXXXKTVDE 271 ETP+PS+KK+ ++HRS +GSS GSRP SH+TD S AS+RSHGD+ K DE Sbjct: 164 ETPQPSRKKRREEHRSGDGSSRGSRPDSHLTDGSLASDRSHGDQSKKKNKKIKDE 218