BLASTX nr result
ID: Ophiopogon27_contig00031559
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031559 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK56913.1| uncharacterized protein A4U43_C10F14570 [Asparagu... 64 2e-09 ref|XP_020249395.1| LOW QUALITY PROTEIN: putative DNA helicase I... 64 3e-09 >gb|ONK56913.1| uncharacterized protein A4U43_C10F14570 [Asparagus officinalis] Length = 285 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 45 QSQNQHCFHHPPEPSMSFSREALFVEKVGHSGGSMFGGVNEEDDEGKDQTGN 200 Q Q QHCFHHP P +SF EA FV K G S G GG++EE+D GN Sbjct: 17 QQQGQHCFHHPSHPPLSFPGEAFFVRKEGRSSGGTLGGMDEEEDHDNSNNGN 68 >ref|XP_020249395.1| LOW QUALITY PROTEIN: putative DNA helicase INO80 [Asparagus officinalis] Length = 378 Score = 64.3 bits (155), Expect = 3e-09 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 45 QSQNQHCFHHPPEPSMSFSREALFVEKVGHSGGSMFGGVNEEDDEGKDQTGN 200 Q Q QHCFHHP P +SF EA FV K G S G GG++EE+D GN Sbjct: 110 QQQGQHCFHHPSHPPLSFPGEAFFVRKEGRSSGGTLGGMDEEEDHDNSNNGN 161