BLASTX nr result
ID: Ophiopogon27_contig00031497
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031497 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPY20991.1| hypothetical protein STCU_08742 [Strigomonas culi... 55 7e-06 gb|EPY23791.1| hypothetical protein STCU_07454 [Strigomonas culi... 55 7e-06 >gb|EPY20991.1| hypothetical protein STCU_08742 [Strigomonas culicis] Length = 479 Score = 54.7 bits (130), Expect = 7e-06 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +2 Query: 290 KAASPPPSVVCFQCGRLGHFRASCPYVVCHACHEFGHRAAVC 415 +AA+ P +C C R GH+ A CP V CHACHE GH ++VC Sbjct: 127 EAANCPQGQLCRMCHRPGHYVAHCPEVTCHACHEKGHTSSVC 168 >gb|EPY23791.1| hypothetical protein STCU_07454 [Strigomonas culicis] Length = 550 Score = 54.7 bits (130), Expect = 7e-06 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +2 Query: 290 KAASPPPSVVCFQCGRLGHFRASCPYVVCHACHEFGHRAAVC 415 +AA+ P +C C R GH+ A CP V CHACHE GH ++VC Sbjct: 198 EAANCPQGQLCRMCHRPGHYVAHCPEVTCHACHEKGHTSSVC 239