BLASTX nr result
ID: Ophiopogon27_contig00031380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031380 (799 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX56890.1| hypothetical protein RirG_212290 [Rhizophagus irr... 107 2e-22 gb|PKY47499.1| Piwi-domain-containing protein [Rhizophagus irreg... 107 2e-22 gb|PKY18901.1| Piwi-domain-containing protein [Rhizophagus irreg... 107 2e-22 gb|EXX56891.1| hypothetical protein RirG_212290 [Rhizophagus irr... 107 2e-22 gb|EXX56889.1| hypothetical protein RirG_212290 [Rhizophagus irr... 107 2e-22 gb|PKK77593.1| Piwi-domain-containing protein [Rhizophagus irreg... 107 2e-22 gb|PKC64722.1| Piwi-domain-containing protein [Rhizophagus irreg... 105 6e-22 gb|PKK77288.1| Piwi-domain-containing protein [Rhizophagus irreg... 102 7e-21 gb|EXX59523.1| hypothetical protein RirG_188390 [Rhizophagus irr... 102 7e-21 gb|EXX63787.1| hypothetical protein RirG_149110 [Rhizophagus irr... 94 9e-21 gb|PKY45941.1| Piwi-domain-containing protein [Rhizophagus irreg... 101 1e-20 dbj|GBC52042.1| Eukaryotic translation initiation factor 2C [Rhi... 100 5e-20 gb|EXX62045.1| hypothetical protein RirG_165360 [Rhizophagus irr... 100 5e-20 gb|POG59741.1| hypothetical protein GLOIN_2v1884825 [Rhizophagus... 100 5e-20 gb|PKK77286.1| Piwi-domain-containing protein [Rhizophagus irreg... 97 7e-19 gb|PKC12813.1| Piwi-domain-containing protein [Rhizophagus irreg... 97 7e-19 gb|EXX59521.1| hypothetical protein RirG_188370 [Rhizophagus irr... 97 7e-19 gb|OZJ02549.1| hypothetical protein BZG36_04505 [Bifiguratus ade... 87 3e-18 gb|POG68199.1| hypothetical protein GLOIN_2v1640045 [Rhizophagus... 86 4e-18 dbj|GBC25182.1| Eukaryotic translation initiation factor 2C 2 [R... 94 6e-18 >gb|EXX56890.1| hypothetical protein RirG_212290 [Rhizophagus irregularis DAOM 197198w] Length = 803 Score = 107 bits (266), Expect = 2e-22 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KVR NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVRTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|PKY47499.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 842 Score = 107 bits (266), Expect = 2e-22 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KVR NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVRTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|PKY18901.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 842 Score = 107 bits (266), Expect = 2e-22 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KVR NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVRTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|EXX56891.1| hypothetical protein RirG_212290 [Rhizophagus irregularis DAOM 197198w] gb|PKC17070.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 842 Score = 107 bits (266), Expect = 2e-22 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KVR NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVRTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|EXX56889.1| hypothetical protein RirG_212290 [Rhizophagus irregularis DAOM 197198w] dbj|GBC35344.1| Eukaryotic translation initiation factor 2C [Rhizophagus irregularis DAOM 181602] gb|POG69750.1| hypothetical protein GLOIN_2v1623940 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 843 Score = 107 bits (266), Expect = 2e-22 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KVR NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVRTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|PKK77593.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 857 Score = 107 bits (266), Expect = 2e-22 Identities = 51/74 (68%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KVR NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVRTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|PKC64722.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 842 Score = 105 bits (262), Expect = 6e-22 Identities = 50/74 (67%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEEP FQLTEFV+RPG+G GK +KV+ NFFE+ LP+ I+HYDVTITP+VP QLNR+V Sbjct: 1 MEEP-FQLTEFVKRPGVGHVGKQMKVQTNFFEITSLPEMEILHYDVTITPEVPQQLNRKV 59 Query: 48 FERFVELNRNGALG 7 F+ F E NR GALG Sbjct: 60 FDLFSEQNRTGALG 73 >gb|PKK77288.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 823 Score = 102 bits (254), Expect = 7e-21 Identities = 46/74 (62%), Positives = 61/74 (82%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T+FVRRPG G +G++I+VR N+F + +PQ +IIHYDVTITP+VP +LNRRV Sbjct: 1 MEEAAFQITQFVRRPGTGRDGRNIRVRTNYFVINDIPQMNIIHYDVTITPEVPQRLNRRV 60 Query: 48 FERFVELNRNGALG 7 F+RFVE ++ ALG Sbjct: 61 FDRFVEQHQGRALG 74 >gb|EXX59523.1| hypothetical protein RirG_188390 [Rhizophagus irregularis DAOM 197198w] dbj|GBC41138.1| Eukaryotic translation initiation factor 2C 2 [Rhizophagus irregularis DAOM 181602] gb|PKC12811.1| Piwi-domain-containing protein [Rhizophagus irregularis] gb|PKC67239.1| Piwi-domain-containing protein [Rhizophagus irregularis] gb|PKY19977.1| Piwi-domain-containing protein [Rhizophagus irregularis] gb|POG80565.1| Piwi domain-containing protein [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 840 Score = 102 bits (254), Expect = 7e-21 Identities = 46/74 (62%), Positives = 61/74 (82%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T+FVRRPG G +G++I+VR N+F + +PQ +IIHYDVTITP+VP +LNRRV Sbjct: 1 MEEAAFQITQFVRRPGTGRDGRNIRVRTNYFVINDIPQMNIIHYDVTITPEVPQRLNRRV 60 Query: 48 FERFVELNRNGALG 7 F+RFVE ++ ALG Sbjct: 61 FDRFVEQHQGRALG 74 >gb|EXX63787.1| hypothetical protein RirG_149110 [Rhizophagus irregularis DAOM 197198w] Length = 89 Score = 93.6 bits (231), Expect = 9e-21 Identities = 45/75 (60%), Positives = 54/75 (72%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T+FV RP +G EG +I+VR NFFEV + +I HYDVTITP VP +LN +V Sbjct: 1 MEEATFQITQFVLRPDIGDEGSNIRVRTNFFEVTNMQDTNISHYDVTITPTVPKRLNWKV 60 Query: 48 FERFVELNRNGALGG 4 F RFVE R ALGG Sbjct: 61 FNRFVEQYREEALGG 75 >gb|PKY45941.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 840 Score = 101 bits (252), Expect = 1e-20 Identities = 46/74 (62%), Positives = 60/74 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T+FVRRPG G +G+ I+VR N+F + +PQ +IIHYDVTITP+VP +LNRRV Sbjct: 1 MEEAAFQITQFVRRPGTGRDGRSIRVRTNYFVINDIPQMNIIHYDVTITPEVPQRLNRRV 60 Query: 48 FERFVELNRNGALG 7 F+RFVE ++ ALG Sbjct: 61 FDRFVEQHQGRALG 74 >dbj|GBC52042.1| Eukaryotic translation initiation factor 2C [Rhizophagus irregularis DAOM 181602] Length = 840 Score = 100 bits (248), Expect = 5e-20 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = -2 Query: 210 QLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRVFERFVE 31 +LTEFV RP LG+ G+HI+VR+NFFE+ LP IIHYDVTITPDVPP LNR++F F + Sbjct: 10 ELTEFVLRPNLGTSGRHIRVRSNFFEITSLPDMEIIHYDVTITPDVPPILNRKIFAEFEK 69 Query: 30 LNRNGALG 7 LN +GALG Sbjct: 70 LNLSGALG 77 >gb|EXX62045.1| hypothetical protein RirG_165360 [Rhizophagus irregularis DAOM 197198w] gb|EXX73212.1| hypothetical protein RirG_062240 [Rhizophagus irregularis DAOM 197198w] Length = 843 Score = 100 bits (248), Expect = 5e-20 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = -2 Query: 210 QLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRVFERFVE 31 +LTEFV RP LG+ G+HI+VR+NFFE+ LP IIHYDVTITPDVPP LNR++F F + Sbjct: 10 ELTEFVLRPNLGTSGRHIRVRSNFFEITSLPDMEIIHYDVTITPDVPPILNRKIFAEFEK 69 Query: 30 LNRNGALG 7 LN +GALG Sbjct: 70 LNLSGALG 77 >gb|POG59741.1| hypothetical protein GLOIN_2v1884825 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 1814 Score = 100 bits (248), Expect = 5e-20 Identities = 45/68 (66%), Positives = 55/68 (80%) Frame = -2 Query: 210 QLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRVFERFVE 31 +LTEFV RP LG+ G+HI+VR+NFFE+ LP IIHYDVTITPDVPP LNR++F F + Sbjct: 10 ELTEFVLRPNLGTSGRHIRVRSNFFEITSLPDMEIIHYDVTITPDVPPILNRKIFAEFEK 69 Query: 30 LNRNGALG 7 LN +GALG Sbjct: 70 LNLSGALG 77 >gb|PKK77286.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 830 Score = 96.7 bits (239), Expect = 7e-19 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T++VRRPG G EG+ ++VR NFFEV+ +P+ +I HYDVTITP VP +LNR++ Sbjct: 1 MEEAAFQITQYVRRPGTGREGRVVRVRTNFFEVITMPETNISHYDVTITPKVPQRLNRKI 60 Query: 48 FERFVELNR 22 F RFVE N+ Sbjct: 61 FNRFVEENQ 69 >gb|PKC12813.1| Piwi-domain-containing protein [Rhizophagus irregularis] gb|PKC67237.1| Piwi-domain-containing protein [Rhizophagus irregularis] gb|PKY19975.1| Piwi-domain-containing protein [Rhizophagus irregularis] Length = 830 Score = 96.7 bits (239), Expect = 7e-19 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T++VRRPG G EG+ ++VR NFFEV+ +P+ +I HYDVTITP VP +LNR++ Sbjct: 1 MEEAAFQITQYVRRPGTGREGRVVRVRTNFFEVITMPETNISHYDVTITPKVPQRLNRKI 60 Query: 48 FERFVELNR 22 F RFVE N+ Sbjct: 61 FNRFVEENQ 69 >gb|EXX59521.1| hypothetical protein RirG_188370 [Rhizophagus irregularis DAOM 197198w] dbj|GBC41140.1| Eukaryotic translation initiation factor 2C 2 [Rhizophagus irregularis DAOM 181602] gb|POG80563.1| hypothetical protein GLOIN_2v1745457 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 830 Score = 96.7 bits (239), Expect = 7e-19 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 228 MEEPLFQLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRV 49 MEE FQ+T++VRRPG G EG+ ++VR NFFEV+ +P+ +I HYDVTITP VP +LNR++ Sbjct: 1 MEEAAFQITQYVRRPGTGREGRVVRVRTNFFEVITMPETNISHYDVTITPKVPQRLNRKI 60 Query: 48 FERFVELNR 22 F RFVE N+ Sbjct: 61 FNRFVEENQ 69 >gb|OZJ02549.1| hypothetical protein BZG36_04505 [Bifiguratus adelaidae] Length = 109 Score = 87.4 bits (215), Expect = 3e-18 Identities = 40/69 (57%), Positives = 51/69 (73%) Frame = -2 Query: 210 QLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRVFERFVE 31 +LTEFV RPGLG G+ +KVR NFF V+ P+ I HYD+ I PDVPP +NR+V++ F E Sbjct: 2 ELTEFVPRPGLGKAGQPVKVRTNFFPVISFPERIIYHYDLNIEPDVPPIINRKVWKHFEE 61 Query: 30 LNRNGALGG 4 LN +GAL G Sbjct: 62 LNLSGALEG 70 >gb|POG68199.1| hypothetical protein GLOIN_2v1640045 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 80 Score = 86.3 bits (212), Expect = 4e-18 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = -2 Query: 210 QLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRVFERFVE 31 ++T FVRRP +G EG+ IKVR N FEV+ +P +IIHYDV+ITP+VPP+LN ++FE FV Sbjct: 2 EITPFVRRPSVGREGRPIKVRTNLFEVITMPTNNIIHYDVSITPEVPPRLNMKIFESFVN 61 Query: 30 LNRNGALG 7 R LG Sbjct: 62 QYREEPLG 69 >dbj|GBC25182.1| Eukaryotic translation initiation factor 2C 2 [Rhizophagus irregularis DAOM 181602] Length = 837 Score = 94.0 bits (232), Expect = 6e-18 Identities = 42/68 (61%), Positives = 55/68 (80%) Frame = -2 Query: 210 QLTEFVRRPGLGSEGKHIKVRANFFEVLQLPQASIIHYDVTITPDVPPQLNRRVFERFVE 31 ++T FVRRPG+G EG+ IKVR NFFEV+ +P+ +IIHYDV+ITP+VPP+LN ++FE FV Sbjct: 2 EITPFVRRPGVGREGRPIKVRTNFFEVITMPENNIIHYDVSITPEVPPRLNMKIFESFVN 61 Query: 30 LNRNGALG 7 R ALG Sbjct: 62 QYRERALG 69