BLASTX nr result
ID: Ophiopogon27_contig00031369
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031369 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261912.1| protein TPX2-like isoform X3 [Asparagus offi... 56 1e-06 ref|XP_020261911.1| protein TPX2-like isoform X2 [Asparagus offi... 56 1e-06 ref|XP_020261910.1| protein TPX2-like isoform X1 [Asparagus offi... 56 1e-06 >ref|XP_020261912.1| protein TPX2-like isoform X3 [Asparagus officinalis] ref|XP_020261913.1| protein TPX2-like isoform X3 [Asparagus officinalis] Length = 443 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +1 Query: 7 QGHKDIHVKEELRRHRIKHIASEGSTLHDYRSKINKPSQRR---GIR 138 QGHKD+HVKEEL RH IK I S STL D RSK+NK R GIR Sbjct: 397 QGHKDVHVKEELTRHGIKDIVSRASTLPDNRSKLNKQRNYRESLGIR 443 >ref|XP_020261911.1| protein TPX2-like isoform X2 [Asparagus officinalis] Length = 461 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +1 Query: 7 QGHKDIHVKEELRRHRIKHIASEGSTLHDYRSKINKPSQRR---GIR 138 QGHKD+HVKEEL RH IK I S STL D RSK+NK R GIR Sbjct: 415 QGHKDVHVKEELTRHGIKDIVSRASTLPDNRSKLNKQRNYRESLGIR 461 >ref|XP_020261910.1| protein TPX2-like isoform X1 [Asparagus officinalis] gb|ONK73069.1| uncharacterized protein A4U43_C04F26830 [Asparagus officinalis] Length = 463 Score = 56.2 bits (134), Expect = 1e-06 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +1 Query: 7 QGHKDIHVKEELRRHRIKHIASEGSTLHDYRSKINKPSQRR---GIR 138 QGHKD+HVKEEL RH IK I S STL D RSK+NK R GIR Sbjct: 417 QGHKDVHVKEELTRHGIKDIVSRASTLPDNRSKLNKQRNYRESLGIR 463