BLASTX nr result
ID: Ophiopogon27_contig00031273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031273 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261465.1| chromatin assembly factor 1 subunit FSM [Asp... 63 2e-08 >ref|XP_020261465.1| chromatin assembly factor 1 subunit FSM [Asparagus officinalis] gb|ONK72400.1| uncharacterized protein A4U43_C04F19030 [Asparagus officinalis] Length = 886 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = -3 Query: 475 TFFSKRCLPPERESISVSGTSPQQCSKTEVLPGDSTQCS 359 TFFSKRCLPP+++S+ S +SPQQCSKT+V+ D TQCS Sbjct: 846 TFFSKRCLPPQKQSVDASESSPQQCSKTKVIAHDGTQCS 884