BLASTX nr result
ID: Ophiopogon27_contig00031234
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00031234 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240822.1| uncharacterized protein LOC109819493 [Aspara... 52 2e-06 >ref|XP_020240822.1| uncharacterized protein LOC109819493 [Asparagus officinalis] gb|ONK59593.1| uncharacterized protein A4U43_C08F8060 [Asparagus officinalis] Length = 439 Score = 51.6 bits (122), Expect(2) = 2e-06 Identities = 29/55 (52%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Frame = +2 Query: 122 MAPLPLRLKITPQTLALTSVRPFSSS----PFPDQNPNSNGENDENRPSNDENRP 274 MAPLPL+LK PQ L LTS+RPFSSS F D NPN E D + S P Sbjct: 1 MAPLPLKLKFKPQNLTLTSLRPFSSSSSTPSFSDPNPNPKPEIDNSLQSPQFRAP 55 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 304 QRHQGAPEIAAVASSADPQRPA 369 QRHQG P I+ A+S P++P+ Sbjct: 58 QRHQGTPAISDGAASPHPRQPS 79