BLASTX nr result
ID: Ophiopogon27_contig00030984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030984 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020240672.1| uncharacterized protein LOC109819373 [Aspara... 57 5e-07 >ref|XP_020240672.1| uncharacterized protein LOC109819373 [Asparagus officinalis] ref|XP_020240673.1| uncharacterized protein LOC109819373 [Asparagus officinalis] gb|ONK59177.1| uncharacterized protein A4U43_C08F3770 [Asparagus officinalis] Length = 1130 Score = 57.4 bits (137), Expect = 5e-07 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 342 MAESSGKPVISRKSKYFTLVESSYSLRRTPARSDSKPNPSS 220 M ESS K +S KSK+FT+VESSYSLR+TPAR++S P PSS Sbjct: 1 MMESSEKTGVSSKSKHFTVVESSYSLRKTPARANSAPKPSS 41