BLASTX nr result
ID: Ophiopogon27_contig00030918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030918 (699 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020090296.1| 3-hydroxy-3-methylglutaryl-coenzyme A reduct... 58 4e-06 >ref|XP_020090296.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like [Ananas comosus] gb|AIT52532.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Ananas comosus] gb|OAY70705.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Ananas comosus] gb|APF32085.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Ananas comosus] Length = 579 Score = 58.2 bits (139), Expect = 4e-06 Identities = 32/52 (61%), Positives = 34/52 (65%) Frame = -1 Query: 699 SPGANXXXXXXXXXXXXXXXXXXLMSALAAGQLVKSHMKYNRSSRDITKAAT 544 SPGAN LMSALAAGQLV+SHMKYNRSSRD+TKAAT Sbjct: 527 SPGANARLLASIVAGGVLAGELSLMSALAAGQLVRSHMKYNRSSRDVTKAAT 578