BLASTX nr result
ID: Ophiopogon27_contig00030903
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030903 (801 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244996.1| uncharacterized protein LOC109823121 [Aspara... 67 7e-15 ref|XP_020253972.1| uncharacterized protein LOC109831044 [Aspara... 65 3e-14 ref|XP_020249261.1| uncharacterized protein LOC109826652 [Aspara... 64 7e-14 ref|XP_020255049.1| uncharacterized protein LOC109832005 [Aspara... 67 3e-10 >ref|XP_020244996.1| uncharacterized protein LOC109823121 [Asparagus officinalis] Length = 1061 Score = 67.0 bits (162), Expect(2) = 7e-15 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 483 GKAIQVDLERSVWEQCRKYILFNCSKVSPFLE 388 GKA QVDLERSVWEQCRKYILFNCS+VSPFLE Sbjct: 738 GKATQVDLERSVWEQCRKYILFNCSEVSPFLE 769 Score = 42.4 bits (98), Expect(2) = 7e-15 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 307 FNRKRMVESRKIQRRKTIREVNNLRNK 227 F KRM E RKI RRKT+REV NLRNK Sbjct: 767 FLEKRMAELRKIHRRKTVREVENLRNK 793 >ref|XP_020253972.1| uncharacterized protein LOC109831044 [Asparagus officinalis] Length = 612 Score = 65.5 bits (158), Expect(2) = 3e-14 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 483 GKAIQVDLERSVWEQCRKYILFNCSKVSPFLE 388 GKA QVDLERS WEQCRKYILFNCS+VSPFLE Sbjct: 423 GKATQVDLERSAWEQCRKYILFNCSEVSPFLE 454 Score = 42.0 bits (97), Expect(2) = 3e-14 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 307 FNRKRMVESRKIQRRKTIREVNNLRNK 227 F KRM E RKI RRKT+REV NLRNK Sbjct: 452 FLEKRMAELRKIYRRKTVREVENLRNK 478 >ref|XP_020249261.1| uncharacterized protein LOC109826652 [Asparagus officinalis] Length = 487 Score = 63.5 bits (153), Expect(2) = 7e-14 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 483 GKAIQVDLERSVWEQCRKYILFNCSKVSPFLE 388 GKA QVDLERSVWEQCRKYILFNC++V PFLE Sbjct: 164 GKATQVDLERSVWEQCRKYILFNCTEVYPFLE 195 Score = 42.4 bits (98), Expect(2) = 7e-14 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -3 Query: 307 FNRKRMVESRKIQRRKTIREVNNLRNK 227 F KRM E RKI RRKT+REV NLRNK Sbjct: 193 FLEKRMAELRKIHRRKTVREVENLRNK 219 >ref|XP_020255049.1| uncharacterized protein LOC109832005 [Asparagus officinalis] Length = 138 Score = 67.0 bits (162), Expect = 3e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 483 GKAIQVDLERSVWEQCRKYILFNCSKVSPFLE 388 GKA QVDLERSVWEQCRKYILFNCS+VSPFLE Sbjct: 107 GKATQVDLERSVWEQCRKYILFNCSEVSPFLE 138