BLASTX nr result
ID: Ophiopogon27_contig00030873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030873 (693 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE65851.1| serine/threonine-protein kinase sty46 [Quercus su... 66 7e-09 gb|EPS59361.1| hypothetical protein M569_15448, partial [Genlise... 55 1e-06 ref|XP_023888734.1| serine/threonine-protein kinase STY46-like [... 59 2e-06 ref|XP_014756465.1| PREDICTED: serine/threonine-protein kinase S... 57 6e-06 ref|XP_010236395.1| PREDICTED: serine/threonine-protein kinase S... 57 6e-06 >gb|POE65851.1| serine/threonine-protein kinase sty46 [Quercus suber] Length = 852 Score = 66.2 bits (160), Expect = 7e-09 Identities = 37/62 (59%), Positives = 41/62 (66%), Gaps = 4/62 (6%) Frame = -1 Query: 174 GDKLFFNKLNYNCLLSFSDS----ICSPPSFLVLKVINHEPYDHKADVFSFAIVLWELAT 7 G K+ F LN +F +S IC P SF LKVI H+PYDHKADVFSFAIVLWEL T Sbjct: 594 GRKIVFEFLNI-LSKTFQESDHFVICLPESFFALKVIEHKPYDHKADVFSFAIVLWELLT 652 Query: 6 LK 1 K Sbjct: 653 GK 654 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 114 ICSPPSFLVLKVINHEPYDHKADVFSFAIVLWELATLK 1 IC P SF LKVI H+PYDHKADVFSFAIVLWEL T K Sbjct: 726 ICLPESFFALKVIEHKPYDHKADVFSFAIVLWELLTGK 763 >gb|EPS59361.1| hypothetical protein M569_15448, partial [Genlisea aurea] Length = 94 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -1 Query: 81 VINHEPYDHKADVFSFAIVLWELATLK 1 VINH+PYDHKADVFSFAIVLWEL T K Sbjct: 1 VINHQPYDHKADVFSFAIVLWELVTAK 27 >ref|XP_023888734.1| serine/threonine-protein kinase STY46-like [Quercus suber] Length = 337 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 105 PPSFLVLKVINHEPYDHKADVFSFAIVLWELATLK 1 P SF LKVI H+PYDHKADVF FAIVLWEL T K Sbjct: 226 PESFFALKVIEHKPYDHKADVFIFAIVLWELLTGK 260 >ref|XP_014756465.1| PREDICTED: serine/threonine-protein kinase STY17-like isoform X2 [Brachypodium distachyon] Length = 515 Score = 57.4 bits (137), Expect = 6e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 84 KVINHEPYDHKADVFSFAIVLWELATLK 1 +VINH+PYDHKADVFSFAIVLWEL TLK Sbjct: 418 EVINHKPYDHKADVFSFAIVLWELVTLK 445 >ref|XP_010236395.1| PREDICTED: serine/threonine-protein kinase STY17-like isoform X1 [Brachypodium distachyon] gb|KQJ94767.1| hypothetical protein BRADI_3g13050v3 [Brachypodium distachyon] Length = 527 Score = 57.4 bits (137), Expect = 6e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 84 KVINHEPYDHKADVFSFAIVLWELATLK 1 +VINH+PYDHKADVFSFAIVLWEL TLK Sbjct: 418 EVINHKPYDHKADVFSFAIVLWELVTLK 445