BLASTX nr result
ID: Ophiopogon27_contig00030460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030460 (534 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267466.1| ubiquitin-like-specific protease 1D [Asparag... 65 6e-09 ref|XP_010237055.1| PREDICTED: uncharacterized protein LOC100827... 58 2e-06 >ref|XP_020267466.1| ubiquitin-like-specific protease 1D [Asparagus officinalis] gb|ONK68435.1| uncharacterized protein A4U43_C05F11470 [Asparagus officinalis] Length = 456 Score = 64.7 bits (156), Expect = 6e-09 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 2/47 (4%) Frame = +1 Query: 1 RKWFQPEDASRLRNKVREVLIEEFESNM--LEDGIQESHASSSASEN 135 RKWF+PEDAS LR+KVREV+ +EFE+NM L+DG+QE AS+SASEN Sbjct: 406 RKWFKPEDASGLRDKVREVVNKEFETNMLKLKDGMQEWRASTSASEN 452 >ref|XP_010237055.1| PREDICTED: uncharacterized protein LOC100827430 [Brachypodium distachyon] gb|KQJ85904.1| hypothetical protein BRADI_4g02360v3 [Brachypodium distachyon] gb|KQJ85905.1| hypothetical protein BRADI_4g02360v3 [Brachypodium distachyon] gb|PNT62361.1| hypothetical protein BRADI_4g02360v3 [Brachypodium distachyon] Length = 693 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = +1 Query: 1 RKWFQPEDASRLRNKVREVLIEEFESNMLEDGIQESHASSSASENG 138 R WF+PEDAS LR ++RE+L+E+FES M++D I E+ S + E G Sbjct: 522 RSWFRPEDASDLRKRIRELLLEQFESEMVDDAISEAATSDGSDEEG 567