BLASTX nr result
ID: Ophiopogon27_contig00030338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030338 (739 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHJ10970.1| cytochrome c oxidase subunit 3 (mitochondrion) [R... 62 8e-08 gb|AFN06112.1| cytochrome c oxidase subunit 3 (mitochondrion) [G... 62 8e-08 ref|YP_003875546.1| cytochrome c oxidase subunit 3 (mitochondrio... 62 8e-08 gb|AFN42482.1| cytochrome c oxidase subunit 3 (mitochondrion) [R... 62 8e-08 ref|YP_002587032.1| cytochrome c oxidase subunit 3 (mitochondrio... 62 8e-08 ref|YP_008474725.1| cytochrome c oxidase subunit 3 (mitochondrio... 60 4e-07 dbj|GBC54036.1| Cytochrome c oxidase subunit III [Rhizophagus ir... 59 9e-07 gb|AMP88012.1| cytochrome c oxidase subunit 3 (mitochondrion) [F... 59 1e-06 ref|YP_009050445.1| cytochrome c oxidase subunit III (mitochondr... 59 2e-06 gb|AEV21530.1| cytochrome c oxidase subunit III, partial (mitoch... 57 2e-06 ref|YP_009233453.1| cytochrome c oxidase subunit 3 (mitochondrio... 57 8e-06 ref|YP_009233070.1| cytochrome c oxidase subunit 3 (mitochondrio... 57 8e-06 >gb|AHJ10970.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus sp. DAOM 213198] Length = 269 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G SWPP IQPIDPWELPLVNTILLLSSGAT Sbjct: 115 GCSWPPAGIQPIDPWELPLVNTILLLSSGAT 145 >gb|AFN06112.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus sp. DAOM 229456] Length = 269 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G SWPP IQPIDPWELPLVNTILLLSSGAT Sbjct: 115 GCSWPPAGIQPIDPWELPLVNTILLLSSGAT 145 >ref|YP_003875546.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] ref|YP_009228198.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus fasciculatus] gb|ADM94802.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGA14225.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGA14257.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGJ98050.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AGJ98074.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus sp. DAOM 240422] gb|AJK91329.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus fasciculatus] gb|AJK91360.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus aggregatum] gb|AML60495.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AML60521.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AML60546.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AML60590.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] Length = 269 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G SWPP IQPIDPWELPLVNTILLLSSGAT Sbjct: 115 GCSWPPAGIQPIDPWELPLVNTILLLSSGAT 145 >gb|AFN42482.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] Length = 270 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G SWPP IQPIDPWELPLVNTILLLSSGAT Sbjct: 116 GCSWPPAGIQPIDPWELPLVNTILLLSSGAT 146 >ref|YP_002587032.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus intraradices] gb|ACM45005.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus intraradices] gb|AFN42451.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AFN42513.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] gb|AMM72610.1| cytochrome c oxidase subunit 3 (mitochondrion) [Rhizophagus irregularis] Length = 270 Score = 62.4 bits (150), Expect = 8e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G SWPP IQPIDPWELPLVNTILLLSSGAT Sbjct: 116 GCSWPPAGIQPIDPWELPLVNTILLLSSGAT 146 >ref|YP_008474725.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus cerebriforme] gb|AGJ98107.1| cytochrome c oxidase subunit 3 (mitochondrion) [Glomus cerebriforme] Length = 269 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G SWPP IQPI+PWELPLVNT+LLLSSGAT Sbjct: 115 GCSWPPAGIQPIEPWELPLVNTVLLLSSGAT 145 >dbj|GBC54036.1| Cytochrome c oxidase subunit III [Rhizophagus irregularis DAOM 181602] Length = 265 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGA 591 G SWPP IQPIDPWELPLVNTILLLSSG+ Sbjct: 96 GCSWPPAGIQPIDPWELPLVNTILLLSSGS 125 >gb|AMP88012.1| cytochrome c oxidase subunit 3 (mitochondrion) [Funneliformis mosseae] Length = 275 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT 588 G +WPP IQPIDPWE PLVNTILLLSSGAT Sbjct: 115 GCAWPPAGIQPIDPWEWPLVNTILLLSSGAT 145 >ref|YP_009050445.1| cytochrome c oxidase subunit III (mitochondrion) [Paraglypturus tonganus (nomen nudum)] gb|AIG22700.1| cytochrome c oxidase subunit III (mitochondrion) [Paraglypturus tonganus (nomen nudum)] Length = 263 Score = 58.5 bits (140), Expect = 2e-06 Identities = 36/108 (33%), Positives = 58/108 (53%), Gaps = 19/108 (17%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT----QEKVSKW*FAESYLADTQTAVRNFF 513 G +WPP IQP +P+++PL+NTI+LLSSGAT + + ++S + T V F+ Sbjct: 115 GMTWPPLGIQPFNPFQIPLLNTIILLSSGATVTWAHHAIMESNHSQSMQSLGLTIVLGFY 174 Query: 512 SFFLKNDSFLSSSYHIIRSVH---------------IRMSLLLNICYY 414 FL+ ++ +S+ I SV+ I SL L++C+Y Sbjct: 175 FTFLQGLEYVEASFTIADSVYGSTFFVATGFHGLHVIIGSLFLSVCWY 222 >gb|AEV21530.1| cytochrome c oxidase subunit III, partial (mitochondrion) [Anguinella palmata] Length = 182 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 5/82 (6%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT-----QEKVSKW*FAESYLADTQTAVRNF 516 G SWPP + P+ PW +PL+NT++LLSSG T V+ W F ++ ++ T V Sbjct: 57 GNSWPPAGVNPLSPWGVPLLNTVVLLSSGVTVTWAHHSLVAGW-FTDTSVSLLLTFVLGA 115 Query: 515 FSFFLKNDSFLSSSYHIIRSVH 450 + FL+ +L +S+ I SV+ Sbjct: 116 YFTFLQAGEYLETSFAISDSVY 137 >ref|YP_009233453.1| cytochrome c oxidase subunit 3 (mitochondrion) [Engaewa subcoerulea] gb|AMB27346.1| cytochrome c oxidase subunit 3 (mitochondrion) [Engaewa subcoerulea] Length = 262 Score = 56.6 bits (135), Expect = 8e-06 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT----QEKVSKW*FAESYLADTQTAVRNFF 513 G WPPT IQP +P+++PL+NT +LLSSGAT + F+E+ + T V F+ Sbjct: 114 GMFWPPTGIQPFNPFQIPLLNTTILLSSGATVTWAHHAILNSNFSEATQSLGITVVLGFY 173 Query: 512 SFFLKNDSFLSSSYHIIRSVH 450 L+ +L SS+ I S++ Sbjct: 174 FTLLQAYEYLESSFSIADSIY 194 >ref|YP_009233070.1| cytochrome c oxidase subunit 3 (mitochondrion) [Engaewa walpolea] gb|AMA98213.1| cytochrome c oxidase subunit 3 (mitochondrion) [Engaewa walpolea] Length = 262 Score = 56.6 bits (135), Expect = 8e-06 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Frame = -3 Query: 680 GRSWPPTSIQPIDPWELPLVNTILLLSSGAT----QEKVSKW*FAESYLADTQTAVRNFF 513 G WPPT IQP +P+++PL+NT +LLSSGAT + F+E+ + T + F+ Sbjct: 114 GMFWPPTGIQPFNPFQIPLLNTTILLSSGATVTWAHHAILNSNFSEAIQSLGITVILGFY 173 Query: 512 SFFLKNDSFLSSSYHIIRSVH 450 L+ +L SS+ I S++ Sbjct: 174 FTLLQAYEYLESSFSIADSIY 194