BLASTX nr result
ID: Ophiopogon27_contig00030083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00030083 (914 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009429017.1| hypothetical protein (chloroplast) [Alpinia ... 60 2e-07 >ref|YP_009429017.1| hypothetical protein (chloroplast) [Alpinia oxyphylla] gb|ASW20479.1| hypothetical protein (chloroplast) [Alpinia oxyphylla] Length = 138 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +3 Query: 702 HTAFYEVIHRPYILESSIIDIFVLSFYHLSIYPHPFIFFLQ 824 + AFYEVIHRPYILES II IFVLSF H SIY H FIF Q Sbjct: 52 YIAFYEVIHRPYILESYIIYIFVLSFSHPSIYLHLFIFASQ 92