BLASTX nr result
ID: Ophiopogon27_contig00029944
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029944 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009393156.1| PREDICTED: serine carboxypeptidase-like 33 [... 60 5e-08 gb|ONM31915.1| Serine carboxypeptidase-like 33 [Zea mays] 60 9e-08 gb|OEL18691.1| Serine carboxypeptidase-like 33 [Dichanthelium ol... 59 2e-07 gb|OQU86810.1| hypothetical protein SORBI_3003G154200 [Sorghum b... 59 2e-07 ref|XP_003565735.2| PREDICTED: serine carboxypeptidase-like 33 [... 58 3e-07 gb|KQK99289.1| hypothetical protein SETIT_010037mg [Setaria ital... 58 4e-07 ref|XP_022684386.1| serine carboxypeptidase-like 26 isoform X6 [... 58 4e-07 ref|XP_022684385.1| serine carboxypeptidase-like 26 isoform X5 [... 58 4e-07 ref|XP_010270860.1| PREDICTED: serine carboxypeptidase-like 33 [... 58 4e-07 ref|XP_022684384.1| serine carboxypeptidase-like 26 isoform X4 [... 58 4e-07 ref|XP_006644136.1| PREDICTED: serine carboxypeptidase-like 33 [... 58 4e-07 ref|XP_015622153.1| PREDICTED: serine carboxypeptidase-like 33 [... 58 4e-07 ref|XP_022684383.1| serine carboxypeptidase-like 26 isoform X3 [... 58 4e-07 ref|XP_022684382.1| serine carboxypeptidase-like 26 isoform X2 [... 58 4e-07 ref|XP_022684381.1| serine carboxypeptidase-like 26 isoform X1 [... 58 4e-07 ref|NP_001148579.2| uncharacterized protein LOC100282195 precurs... 57 6e-07 gb|ACN33679.1| unknown [Zea mays] 57 6e-07 gb|ACG32104.1| SCPL33 [Zea mays] 57 6e-07 gb|PNY16203.1| serine carboxypeptidase 33-like protein, partial ... 57 7e-07 ref|XP_019463274.1| PREDICTED: serine carboxypeptidase-like 33 i... 57 8e-07 >ref|XP_009393156.1| PREDICTED: serine carboxypeptidase-like 33 [Musa acuminata subsp. malaccensis] Length = 458 Score = 60.5 bits (145), Expect = 5e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILRTYNF+VFS LPIYSKLIKAGLRIWLY Sbjct: 345 SILRTYNFTVFSVLPIYSKLIKAGLRIWLY 374 >gb|ONM31915.1| Serine carboxypeptidase-like 33 [Zea mays] Length = 414 Score = 59.7 bits (143), Expect = 9e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLYRF 97 SILR+YNFSV S LPIYSKLIKAGLR+WLYR+ Sbjct: 383 SILRSYNFSVLSVLPIYSKLIKAGLRVWLYRW 414 >gb|OEL18691.1| Serine carboxypeptidase-like 33 [Dichanthelium oligosanthes] Length = 495 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = +2 Query: 5 ILRTYNFSVFSTLPIYSKLIKAGLRIWLYRFGPFSECICFTF 130 IL +YNFSVFS LPIYSKLIKAGLR+WLY P S+ + ++ Sbjct: 370 ILNSYNFSVFSVLPIYSKLIKAGLRVWLYSPSPKSKSLYLSY 411 >gb|OQU86810.1| hypothetical protein SORBI_3003G154200 [Sorghum bicolor] Length = 519 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLYRF 97 SILR+YNFSV S LPIYSKLIK+GLR+WLYR+ Sbjct: 480 SILRSYNFSVLSILPIYSKLIKSGLRVWLYRY 511 >ref|XP_003565735.2| PREDICTED: serine carboxypeptidase-like 33 [Brachypodium distachyon] gb|KQK04226.1| hypothetical protein BRADI_2g12450v3 [Brachypodium distachyon] Length = 487 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILRTYNFSV S LPIYSKLIKAGLR+W+Y Sbjct: 374 SILRTYNFSVLSVLPIYSKLIKAGLRVWIY 403 >gb|KQK99289.1| hypothetical protein SETIT_010037mg [Setaria italica] Length = 465 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 352 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 381 >ref|XP_022684386.1| serine carboxypeptidase-like 26 isoform X6 [Setaria italica] Length = 471 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 245 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 274 >ref|XP_022684385.1| serine carboxypeptidase-like 26 isoform X5 [Setaria italica] Length = 473 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 360 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 389 >ref|XP_010270860.1| PREDICTED: serine carboxypeptidase-like 33 [Nelumbo nucifera] Length = 478 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL+TYNF+VFST+PIY+KLIKAGLRIW+Y Sbjct: 364 SILQTYNFTVFSTMPIYTKLIKAGLRIWVY 393 >ref|XP_022684384.1| serine carboxypeptidase-like 26 isoform X4 [Setaria italica] Length = 488 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 360 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 389 >ref|XP_006644136.1| PREDICTED: serine carboxypeptidase-like 33 [Oryza brachyantha] ref|XP_015698196.1| PREDICTED: serine carboxypeptidase-like 33 [Oryza brachyantha] ref|XP_015698201.1| PREDICTED: serine carboxypeptidase-like 33 [Oryza brachyantha] ref|XP_015698208.1| PREDICTED: serine carboxypeptidase-like 33 [Oryza brachyantha] Length = 498 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILR+YNFSV S LPIYSKLIKAGLRIWLY Sbjct: 385 SILRSYNFSVLSVLPIYSKLIKAGLRIWLY 414 >ref|XP_015622153.1| PREDICTED: serine carboxypeptidase-like 33 [Oryza sativa Japonica Group] dbj|BAD53500.1| putative serine carboxypeptidase II, CP-MII [Oryza sativa Japonica Group] dbj|BAF04846.1| Os01g0332500 [Oryza sativa Japonica Group] dbj|BAS71922.1| Os01g0332500 [Oryza sativa Japonica Group] Length = 500 Score = 57.8 bits (138), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILR+YNFSV S LPIYSKLIKAGLRIWLY Sbjct: 387 SILRSYNFSVLSVLPIYSKLIKAGLRIWLY 416 >ref|XP_022684383.1| serine carboxypeptidase-like 26 isoform X3 [Setaria italica] Length = 505 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 279 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 308 >ref|XP_022684382.1| serine carboxypeptidase-like 26 isoform X2 [Setaria italica] Length = 510 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 360 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 389 >ref|XP_022684381.1| serine carboxypeptidase-like 26 isoform X1 [Setaria italica] Length = 578 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SIL +YNFSVFS LPIYSKLIKAGLR+WLY Sbjct: 352 SILNSYNFSVFSVLPIYSKLIKAGLRVWLY 381 >ref|NP_001148579.2| uncharacterized protein LOC100282195 precursor [Zea mays] gb|ACN34686.1| unknown [Zea mays] gb|ONM31913.1| Serine carboxypeptidase-like 33 [Zea mays] Length = 496 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILR+YNFSV S LPIYSKLIKAGLR+WLY Sbjct: 383 SILRSYNFSVLSVLPIYSKLIKAGLRVWLY 412 >gb|ACN33679.1| unknown [Zea mays] Length = 496 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILR+YNFSV S LPIYSKLIKAGLR+WLY Sbjct: 383 SILRSYNFSVLSVLPIYSKLIKAGLRVWLY 412 >gb|ACG32104.1| SCPL33 [Zea mays] Length = 496 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILR+YNFSV S LPIYSKLIKAGLR+WLY Sbjct: 383 SILRSYNFSVLSVLPIYSKLIKAGLRVWLY 412 >gb|PNY16203.1| serine carboxypeptidase 33-like protein, partial [Trifolium pratense] Length = 387 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILRTYNFSVFS LPIY+KLIK GL+IW+Y Sbjct: 322 SILRTYNFSVFSVLPIYTKLIKGGLKIWIY 351 >ref|XP_019463274.1| PREDICTED: serine carboxypeptidase-like 33 isoform X2 [Lupinus angustifolius] Length = 452 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 2 SILRTYNFSVFSTLPIYSKLIKAGLRIWLY 91 SILRTYNFSVFS LPIY+KLIK GL+IW+Y Sbjct: 376 SILRTYNFSVFSVLPIYTKLIKGGLKIWIY 405