BLASTX nr result
ID: Ophiopogon27_contig00029805
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029805 (493 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010927679.1| PREDICTED: kinetochore protein nuf2 [Elaeis ... 63 2e-08 >ref|XP_010927679.1| PREDICTED: kinetochore protein nuf2 [Elaeis guineensis] Length = 454 Score = 63.2 bits (152), Expect = 2e-08 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 2/73 (2%) Frame = +1 Query: 31 RSEKLERV--NNDNICLEADAVREAGKGKQRQLHAKLKGIIEAFNCHSKMVEEALQSVEV 204 R K+E + DN+C +A +VREAGK KQ++LHAKL+ I+ AF+ +S + LQ +EV Sbjct: 382 RERKVEALVAKGDNLCSDASSVREAGKAKQQELHAKLEEIVRAFHSYSSTISSLLQRIEV 441 Query: 205 NVANEEWLGIGIT 243 V +E LG IT Sbjct: 442 GV-EKEALGTEIT 453