BLASTX nr result
ID: Ophiopogon27_contig00029697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029697 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK76306.1| hypothetical protein RhiirC2_734693 [Rhizophagus ... 55 2e-06 dbj|GBC26489.1| hypothetical protein RIR_1274700 [Rhizophagus ir... 55 2e-06 gb|PKY39634.1| hypothetical protein RhiirA4_415193 [Rhizophagus ... 53 8e-06 >gb|PKK76306.1| hypothetical protein RhiirC2_734693 [Rhizophagus irregularis] Length = 268 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = -3 Query: 219 KRKPTDHHHERDKH----EKSKNELKTLLAKFGNNQKVEDELDNDINKMRSQLQAIQMK 55 KRKP ERDK EKS NELK+LLA+FG KV D++++D ++RS ++A+ K Sbjct: 53 KRKPLTIESERDKQKAELEKSGNELKSLLAQFGTKAKVADDIESDAKRLRSNIEALMAK 111 >dbj|GBC26489.1| hypothetical protein RIR_1274700 [Rhizophagus irregularis DAOM 181602] gb|PKC17584.1| hypothetical protein RhiirA5_346056 [Rhizophagus irregularis] gb|PKC73662.1| hypothetical protein RhiirA1_410261 [Rhizophagus irregularis] gb|PKY19574.1| hypothetical protein RhiirB3_407024 [Rhizophagus irregularis] gb|POG70997.1| hypothetical protein GLOIN_2v1610574 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 268 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = -3 Query: 219 KRKPTDHHHERDKH----EKSKNELKTLLAKFGNNQKVEDELDNDINKMRSQLQAIQMK 55 KRKP ERDK EKS NELK+LLA+FG KV D++++D ++RS ++A+ K Sbjct: 53 KRKPLTIESERDKQKAELEKSGNELKSLLAQFGTKAKVADDIESDAKRLRSNIEALMAK 111 >gb|PKY39634.1| hypothetical protein RhiirA4_415193 [Rhizophagus irregularis] Length = 179 Score = 52.8 bits (125), Expect = 8e-06 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 4/59 (6%) Frame = -3 Query: 219 KRKPTDHHHERDKH----EKSKNELKTLLAKFGNNQKVEDELDNDINKMRSQLQAIQMK 55 KRKP ERDK EKS N+LK+LLA+FG KV D++++D ++R+ ++A+ K Sbjct: 53 KRKPLTIESERDKQKAELEKSGNKLKSLLAQFGTKAKVADDIESDAKRLRNNIEALMAK 111