BLASTX nr result
ID: Ophiopogon27_contig00029665
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029665 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020248854.1| potassium transporter 5-like [Asparagus offi... 81 3e-15 ref|XP_020250581.1| LOW QUALITY PROTEIN: potassium transporter 5... 80 6e-15 gb|ONK78290.1| uncharacterized protein A4U43_C02F16730 [Asparagu... 80 6e-15 ref|XP_020254491.1| potassium transporter 5-like [Asparagus offi... 80 7e-15 ref|XP_020245753.1| potassium transporter 5-like [Asparagus offi... 76 1e-13 gb|ONK58648.1| uncharacterized protein A4U43_C09F15240 [Asparagu... 76 1e-13 ref|XP_020106530.1| potassium transporter 5-like [Ananas comosus] 70 3e-11 ref|XP_017970280.1| PREDICTED: potassium transporter 5 [Theobrom... 69 4e-11 ref|XP_022748918.1| potassium transporter 5 [Durio zibethinus] 69 7e-11 ref|XP_017622551.1| PREDICTED: potassium transporter 5 [Gossypiu... 68 1e-10 gb|PPS10068.1| hypothetical protein GOBAR_AA10576 [Gossypium bar... 68 1e-10 ref|XP_016711522.1| PREDICTED: potassium transporter 5-like [Gos... 68 1e-10 gb|KJB16112.1| hypothetical protein B456_002G213100 [Gossypium r... 67 2e-10 gb|KJB16114.1| hypothetical protein B456_002G213100 [Gossypium r... 67 2e-10 gb|PKA56858.1| Potassium transporter 5 [Apostasia shenzhenica] 67 2e-10 gb|KJB16113.1| hypothetical protein B456_002G213100 [Gossypium r... 67 2e-10 ref|XP_016706399.1| PREDICTED: potassium transporter 5-like [Gos... 67 2e-10 ref|XP_012467779.1| PREDICTED: potassium transporter 5-like [Gos... 67 2e-10 gb|ONK56257.1| uncharacterized protein A4U43_C10F5730 [Asparagus... 67 2e-10 gb|PPD74626.1| hypothetical protein GOBAR_DD28445 [Gossypium bar... 67 2e-10 >ref|XP_020248854.1| potassium transporter 5-like [Asparagus officinalis] Length = 685 Score = 81.3 bits (199), Expect = 3e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 SIIKRIVVDY+YNFMRRNFRQGGE M IPRSRLLKVGMTYEI Sbjct: 644 SIIKRIVVDYVYNFMRRNFRQGGEAMKIPRSRLLKVGMTYEI 685 >ref|XP_020250581.1| LOW QUALITY PROTEIN: potassium transporter 5-like, partial [Asparagus officinalis] Length = 456 Score = 80.1 bits (196), Expect = 6e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 SIIKRIVVDY+YNFMRRNFRQGGE M IPRS+LLKVGMTYEI Sbjct: 415 SIIKRIVVDYVYNFMRRNFRQGGEAMKIPRSKLLKVGMTYEI 456 >gb|ONK78290.1| uncharacterized protein A4U43_C02F16730 [Asparagus officinalis] Length = 665 Score = 80.1 bits (196), Expect = 6e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 SIIKRIVVDY+YNFMRRNFRQGGE M IPRS+LLKVGMTYEI Sbjct: 624 SIIKRIVVDYVYNFMRRNFRQGGEAMKIPRSKLLKVGMTYEI 665 >ref|XP_020254491.1| potassium transporter 5-like [Asparagus officinalis] Length = 750 Score = 80.1 bits (196), Expect = 7e-15 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 SIIKRIVVDY+YNFMRRNFRQGGE M IPRS+LLKVGMTYEI Sbjct: 709 SIIKRIVVDYVYNFMRRNFRQGGEAMKIPRSKLLKVGMTYEI 750 >ref|XP_020245753.1| potassium transporter 5-like [Asparagus officinalis] Length = 797 Score = 76.3 bits (186), Expect = 1e-13 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S +KR+VV+Y+Y+FMR+NFRQGG+VMMIPRSRLLKVGMTYEI Sbjct: 756 SFLKRVVVNYVYSFMRKNFRQGGDVMMIPRSRLLKVGMTYEI 797 >gb|ONK58648.1| uncharacterized protein A4U43_C09F15240 [Asparagus officinalis] Length = 840 Score = 76.3 bits (186), Expect = 1e-13 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S +KR+VV+Y+Y+FMR+NFRQGG+VMMIPRSRLLKVGMTYEI Sbjct: 799 SFLKRVVVNYVYSFMRKNFRQGGDVMMIPRSRLLKVGMTYEI 840 >ref|XP_020106530.1| potassium transporter 5-like [Ananas comosus] Length = 812 Score = 69.7 bits (169), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 SI+K+I+V+Y+YNFMRRN RQG V+MIPR +LLKVGMTYEI Sbjct: 771 SILKKIIVNYIYNFMRRNSRQGDRVLMIPRDKLLKVGMTYEI 812 >ref|XP_017970280.1| PREDICTED: potassium transporter 5 [Theobroma cacao] gb|EOX99564.1| High affinity K+ transporter 5 [Theobroma cacao] Length = 810 Score = 69.3 bits (168), Expect = 4e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S IK+I+VDY+YNF+R+NFRQG +VM+IP +RLL+VGMTYEI Sbjct: 769 SFIKKIIVDYVYNFLRKNFRQGEKVMVIPHTRLLRVGMTYEI 810 >ref|XP_022748918.1| potassium transporter 5 [Durio zibethinus] Length = 806 Score = 68.6 bits (166), Expect = 7e-11 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S IK+I+VDY+Y+F+R+NFRQG +VM+IP SRLL+VGMTYEI Sbjct: 765 SCIKKIIVDYVYSFLRKNFRQGDKVMVIPHSRLLRVGMTYEI 806 >ref|XP_017622551.1| PREDICTED: potassium transporter 5 [Gossypium arboreum] Length = 797 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR++VDY YNF+RRNFRQG +VMMIP++RLL+VGMTYEI Sbjct: 756 SYTKRMIVDYGYNFLRRNFRQGEKVMMIPQTRLLRVGMTYEI 797 >gb|PPS10068.1| hypothetical protein GOBAR_AA10576 [Gossypium barbadense] Length = 809 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR++VDY YNF+RRNFRQG +VMMIP++RLL+VGMTYEI Sbjct: 768 SYTKRMIVDYGYNFLRRNFRQGEKVMMIPQTRLLRVGMTYEI 809 >ref|XP_016711522.1| PREDICTED: potassium transporter 5-like [Gossypium hirsutum] Length = 816 Score = 68.2 bits (165), Expect = 1e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR++VDY YNF+RRNFRQG +VMMIP++RLL+VGMTYEI Sbjct: 775 SYTKRMIVDYGYNFLRRNFRQGEKVMMIPQTRLLRVGMTYEI 816 >gb|KJB16112.1| hypothetical protein B456_002G213100 [Gossypium raimondii] Length = 491 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR+VVDY YNF+RRNFRQG +VMMIP+++LL+VGMTYEI Sbjct: 450 SYTKRMVVDYGYNFLRRNFRQGEKVMMIPQAKLLRVGMTYEI 491 >gb|KJB16114.1| hypothetical protein B456_002G213100 [Gossypium raimondii] Length = 628 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR+VVDY YNF+RRNFRQG +VMMIP+++LL+VGMTYEI Sbjct: 587 SYTKRMVVDYGYNFLRRNFRQGEKVMMIPQAKLLRVGMTYEI 628 >gb|PKA56858.1| Potassium transporter 5 [Apostasia shenzhenica] Length = 673 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 SIIKR+VV+++YNF+RRNF QG E M IP++RLLKVGMTYEI Sbjct: 632 SIIKRVVVNHVYNFIRRNFIQGDEAMAIPKARLLKVGMTYEI 673 >gb|KJB16113.1| hypothetical protein B456_002G213100 [Gossypium raimondii] Length = 809 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR+VVDY YNF+RRNFRQG +VMMIP+++LL+VGMTYEI Sbjct: 768 SYTKRMVVDYGYNFLRRNFRQGEKVMMIPQAKLLRVGMTYEI 809 >ref|XP_016706399.1| PREDICTED: potassium transporter 5-like [Gossypium hirsutum] Length = 816 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR+VVDY YNF+RRNFRQG +VMMIP+++LL+VGMTYEI Sbjct: 775 SYTKRMVVDYGYNFLRRNFRQGEKVMMIPQTKLLRVGMTYEI 816 >ref|XP_012467779.1| PREDICTED: potassium transporter 5-like [Gossypium raimondii] ref|XP_012467780.1| PREDICTED: potassium transporter 5-like [Gossypium raimondii] ref|XP_012467781.1| PREDICTED: potassium transporter 5-like [Gossypium raimondii] Length = 816 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR+VVDY YNF+RRNFRQG +VMMIP+++LL+VGMTYEI Sbjct: 775 SYTKRMVVDYGYNFLRRNFRQGEKVMMIPQAKLLRVGMTYEI 816 >gb|ONK56257.1| uncharacterized protein A4U43_C10F5730 [Asparagus officinalis] Length = 843 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLK 107 SIIKRIVVDY+YNFMRRNFRQGGE M IPRSRLLK Sbjct: 624 SIIKRIVVDYVYNFMRRNFRQGGEAMKIPRSRLLK 658 >gb|PPD74626.1| hypothetical protein GOBAR_DD28445 [Gossypium barbadense] Length = 901 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +3 Query: 3 SIIKRIVVDYLYNFMRRNFRQGGEVMMIPRSRLLKVGMTYEI 128 S KR+VVDY YNF+RRNFRQG +VMMIP+++LL+VGMTYEI Sbjct: 860 SYTKRMVVDYGYNFLRRNFRQGEKVMMIPQTKLLRVGMTYEI 901