BLASTX nr result
ID: Ophiopogon27_contig00029655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029655 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247740.1| pentatricopeptide repeat-containing protein ... 64 6e-09 >ref|XP_020247740.1| pentatricopeptide repeat-containing protein At1g55630-like [Asparagus officinalis] ref|XP_020247741.1| pentatricopeptide repeat-containing protein At1g55630-like [Asparagus officinalis] ref|XP_020247742.1| pentatricopeptide repeat-containing protein At1g55630-like [Asparagus officinalis] gb|ONK57051.1| uncharacterized protein A4U43_C10F16100 [Asparagus officinalis] Length = 477 Score = 63.9 bits (154), Expect = 6e-09 Identities = 32/70 (45%), Positives = 42/70 (60%) Frame = +2 Query: 251 PSFNLCCNNGHPSDDNDETPNSNPNPKKTDFDHNYDDTFLNIPLIEEDQENSSAEFTPRR 430 P FN C N +D+ E ++DFD NYDDT L++P +E +E EFTPRR Sbjct: 24 PCFNFCSNGDRSNDEEKE---------RSDFDRNYDDTLLSLPPFKEHEE----EFTPRR 70 Query: 431 RFFQGVKLEA 460 RFF+ +KLEA Sbjct: 71 RFFRNIKLEA 80