BLASTX nr result
ID: Ophiopogon27_contig00029624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029624 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK62690.1| uncharacterized protein A4U43_C07F6950 [Asparagus... 60 4e-08 ref|XP_020273782.1| RNA pseudouridine synthase 5 [Asparagus offi... 60 3e-07 >gb|ONK62690.1| uncharacterized protein A4U43_C07F6950 [Asparagus officinalis] Length = 143 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 QLICCHPSTNEMVAITAPLPSILQTRKELAKETF 103 +LI CHPSTNEMV ITAPLP IL+TRKEL KETF Sbjct: 110 RLIFCHPSTNEMVEITAPLPPILKTRKELVKETF 143 >ref|XP_020273782.1| RNA pseudouridine synthase 5 [Asparagus officinalis] Length = 386 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 QLICCHPSTNEMVAITAPLPSILQTRKELAKETF 103 +LI CHPSTNEMV ITAPLP IL+TRKEL KETF Sbjct: 353 RLIFCHPSTNEMVEITAPLPPILKTRKELVKETF 386