BLASTX nr result
ID: Ophiopogon27_contig00029545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029545 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB14970.1| hypothetical protein B456_002G152100, partial [Go... 80 1e-15 gb|OMP12403.1| ORF46h [Corchorus olitorius] 70 3e-13 gb|KZV47268.1| hypothetical protein F511_07691 [Dorcoceras hygro... 67 7e-12 ref|YP_001152246.1| ORF67g [Pinus koraiensis] >gi|145048871|gb|A... 65 3e-11 gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partia... 61 1e-09 gb|PHT34490.1| hypothetical protein CQW23_26290 [Capsicum baccatum] 61 3e-08 gb|PPS15683.1| hypothetical protein GOBAR_AA04891 [Gossypium bar... 60 4e-08 ref|XP_013463266.1| hypothetical protein MTR_2g436990 [Medicago ... 59 1e-07 ref|NP_054981.1| hypothetical protein SpolCp077 (plastid) [Spina... 54 3e-07 gb|PPS03373.1| hypothetical protein GOBAR_AA17289 [Gossypium bar... 58 5e-07 emb|CDY45546.1| BnaCnng13050D [Brassica napus] 52 8e-07 gb|ERN16192.1| hypothetical protein AMTR_s00030p00239160 [Ambore... 54 1e-06 >gb|KJB14970.1| hypothetical protein B456_002G152100, partial [Gossypium raimondii] Length = 252 Score = 80.5 bits (197), Expect = 1e-15 Identities = 48/99 (48%), Positives = 49/99 (49%) Frame = -3 Query: 347 GASQNRKTHIGFRDNQARTDDFHHVKVTLYR*VISLPGPHREIELTNPKAKGRETQRYYS 168 GA QNRKTHI FRDNQART+DFHHVK Sbjct: 150 GAWQNRKTHIRFRDNQARTNDFHHVK---------------------------------- 175 Query: 167 *TTWSRAFFSHYYG**NNGKNWIQLSTTPIGNWIDYGFE 51 AF SHYYG NN K WIQLST PI N IDYGFE Sbjct: 176 ------AFLSHYYGYENNRKIWIQLSTAPIRNKIDYGFE 208 >gb|OMP12403.1| ORF46h [Corchorus olitorius] Length = 64 Score = 69.7 bits (169), Expect = 3e-13 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 350 GGASQNRKTHIGFRDNQARTDDFHHVKVTLYR 255 GGA QNRKTHIGFRDNQARTDDFHHVKVTLYR Sbjct: 33 GGARQNRKTHIGFRDNQARTDDFHHVKVTLYR 64 >gb|KZV47268.1| hypothetical protein F511_07691 [Dorcoceras hygrometricum] Length = 79 Score = 66.6 bits (161), Expect = 7e-12 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = +3 Query: 228 MGAGKGYNSAVECHLDVVEVISSSLIIPKPNVSFSILTCSPAAIE 362 MGAGKGYNSAVECHLDVVEVISSSLIIPKPN L S + +E Sbjct: 1 MGAGKGYNSAVECHLDVVEVISSSLIIPKPNSKGGNLLASFSELE 45 >ref|YP_001152246.1| ORF67g [Pinus koraiensis] gb|ABP35486.1| ORF67g (chloroplast) [Pinus koraiensis] Length = 67 Score = 64.7 bits (156), Expect = 3e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 228 MGAGKGYNSAVECHLDVVEVISSSLIIPKPNVSFSI 335 M GKGYNSAVECHLD+VEVISSSLIIPKPNVS SI Sbjct: 1 MRVGKGYNSAVECHLDMVEVISSSLIIPKPNVSPSI 36 >gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] Length = 77 Score = 60.8 bits (146), Expect = 1e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 370 HSRSIAAGEQVKIEKLTLGLGIIRLELMTSTTS 272 HS SI AGEQVKIEKLTLGLGIIRLELMTSTTS Sbjct: 45 HSHSITAGEQVKIEKLTLGLGIIRLELMTSTTS 77 >gb|PHT34490.1| hypothetical protein CQW23_26290 [Capsicum baccatum] Length = 330 Score = 61.2 bits (147), Expect = 3e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -3 Query: 350 GGASQNRKTHIGFRDNQARTDDFHHVKVTLYR 255 GGA+ RKTHIG RDNQARTDDFHHVKV LYR Sbjct: 299 GGANPTRKTHIGLRDNQARTDDFHHVKVKLYR 330 >gb|PPS15683.1| hypothetical protein GOBAR_AA04891 [Gossypium barbadense] Length = 210 Score = 59.7 bits (143), Expect = 4e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 347 GASQNRKTHIGFRDNQARTDDFHHVKVTLY 258 GA +NRK HIGFRDNQAR DDFHHVKVTLY Sbjct: 180 GARKNRKNHIGFRDNQARIDDFHHVKVTLY 209 >ref|XP_013463266.1| hypothetical protein MTR_2g436990 [Medicago truncatula] gb|KEH37278.1| hypothetical protein MTR_2g436990 [Medicago truncatula] Length = 352 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 231 GAGKGYNSAVECHLDVVEVISSSLIIPKPN 320 G GKGYNSAVECHLDVVEVI S+LIIPKPN Sbjct: 321 GQGKGYNSAVECHLDVVEVIGSNLIIPKPN 350 >ref|NP_054981.1| hypothetical protein SpolCp077 (plastid) [Spinacia oleracea] ref|NP_054998.1| hypothetical protein SpolCp096 (plastid) [Spinacia oleracea] emb|CAB88777.1| hypothetical protein (chloroplast) [Spinacia oleracea] emb|CAB88794.1| hypothetical protein (chloroplast) [Spinacia oleracea] Length = 54 Score = 53.9 bits (128), Expect = 3e-07 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 115 MGKIGFNCQLLLSEIGLTTDSSHSTWFHK 29 MGK GFNCQLLLSEIG TTD +HST FHK Sbjct: 1 MGKFGFNCQLLLSEIGFTTDLNHSTCFHK 29 >gb|PPS03373.1| hypothetical protein GOBAR_AA17289 [Gossypium barbadense] Length = 847 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 240 KGYNSAVECHLDVVEVISSSLIIPKPN 320 KGYNSAVECHLDVVEVISSSLIIPKPN Sbjct: 391 KGYNSAVECHLDVVEVISSSLIIPKPN 417 >emb|CDY45546.1| BnaCnng13050D [Brassica napus] Length = 62 Score = 52.4 bits (124), Expect(2) = 8e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = -3 Query: 326 THIGFRDNQARTDDFHHVKVTLYR 255 T IGFRDNQARTDDFHHVKVTLYR Sbjct: 39 TFIGFRDNQARTDDFHHVKVTLYR 62 Score = 28.5 bits (62), Expect(2) = 8e-07 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -1 Query: 370 HSRSIAAGEQVKIEKLT 320 HS SI A EQVKIEKLT Sbjct: 23 HSYSITAREQVKIEKLT 39 >gb|ERN16192.1| hypothetical protein AMTR_s00030p00239160 [Amborella trichopoda] Length = 89 Score = 53.5 bits (127), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 350 GGASQNRKTHIGFRDNQARTDDFHHVKVTLYR 255 GGASQN+K IGFRDN ART +FHHVKVTL R Sbjct: 58 GGASQNKKACIGFRDNHARTYEFHHVKVTLDR 89