BLASTX nr result
ID: Ophiopogon27_contig00029359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029359 (523 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK72666.1| uncharacterized protein A4U43_C04F21820 [Asparagu... 100 2e-21 ref|XP_020261675.1| pentatricopeptide repeat-containing protein ... 100 2e-21 >gb|ONK72666.1| uncharacterized protein A4U43_C04F21820 [Asparagus officinalis] Length = 574 Score = 100 bits (249), Expect = 2e-21 Identities = 53/73 (72%), Positives = 59/73 (80%) Frame = +1 Query: 304 MATAVPQSFCGNSTPSPPSPLLKQGTISSSTNVNRKPPVTKLRNSVIARRLSSLTESGQM 483 MATA+ QSFC NS S S L KQ +ISSSTNV K P++KL NSVIARRLSSLTESGQM Sbjct: 1 MATAILQSFCNNSNTSQTSSLPKQASISSSTNVKTKQPISKLHNSVIARRLSSLTESGQM 60 Query: 484 GEALALFQAAKKP 522 EAL+LFQ+AKKP Sbjct: 61 HEALSLFQSAKKP 73 >ref|XP_020261675.1| pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Asparagus officinalis] Length = 785 Score = 100 bits (249), Expect = 2e-21 Identities = 53/73 (72%), Positives = 59/73 (80%) Frame = +1 Query: 304 MATAVPQSFCGNSTPSPPSPLLKQGTISSSTNVNRKPPVTKLRNSVIARRLSSLTESGQM 483 MATA+ QSFC NS S S L KQ +ISSSTNV K P++KL NSVIARRLSSLTESGQM Sbjct: 1 MATAILQSFCNNSNTSQTSSLPKQASISSSTNVKTKQPISKLHNSVIARRLSSLTESGQM 60 Query: 484 GEALALFQAAKKP 522 EAL+LFQ+AKKP Sbjct: 61 HEALSLFQSAKKP 73