BLASTX nr result
ID: Ophiopogon27_contig00029309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029309 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAV60383.1| UBN2 domain-containing protein, partial [Cephalo... 64 3e-10 dbj|GAV82333.1| UBN2 domain-containing protein, partial [Cephalo... 63 4e-10 dbj|GAV61348.1| UBN2 domain-containing protein, partial [Cephalo... 63 6e-10 dbj|GAV58829.1| UBN2 domain-containing protein, partial [Cephalo... 62 1e-09 dbj|GAV63689.1| UBN2 domain-containing protein, partial [Cephalo... 62 1e-09 dbj|GAV70805.1| UBN2 domain-containing protein, partial [Cephalo... 62 1e-09 dbj|GAV87116.1| UBN2 domain-containing protein, partial [Cephalo... 62 2e-09 dbj|GAV83725.1| UBN2 domain-containing protein, partial [Cephalo... 63 2e-09 dbj|GAV81443.1| UBN2 domain-containing protein, partial [Cephalo... 62 2e-09 dbj|GAV73843.1| UBN2 domain-containing protein [Cephalotus folli... 64 2e-09 dbj|GAV58068.1| DUF4219 domain-containing protein/UBN2 domain-co... 64 2e-09 dbj|GAV65035.1| UBN2 domain-containing protein, partial [Cephalo... 61 2e-09 dbj|GAV58821.1| UBN2 domain-containing protein, partial [Cephalo... 61 2e-09 dbj|GAV60936.1| UBN2 domain-containing protein, partial [Cephalo... 61 2e-09 dbj|GAV61938.1| UBN2 domain-containing protein, partial [Cephalo... 61 2e-09 dbj|GAV66317.1| UBN2 domain-containing protein, partial [Cephalo... 61 2e-09 dbj|GAV80145.1| UBN2 domain-containing protein, partial [Cephalo... 62 3e-09 dbj|GAV66244.1| zf-CCHC domain-containing protein/DUF4219 domain... 64 3e-09 dbj|GAV81440.1| UBN2 domain-containing protein, partial [Cephalo... 61 3e-09 dbj|GAV83994.1| UBN2 domain-containing protein, partial [Cephalo... 61 3e-09 >dbj|GAV60383.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 63.5 bits (153), Expect = 3e-10 Identities = 32/78 (41%), Positives = 44/78 (56%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + F +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPFEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDDEEQDKKKKKVIAFKS 89 >dbj|GAV82333.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 63.2 bits (152), Expect = 4e-10 Identities = 31/79 (39%), Positives = 44/79 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKAF 173 ED Q KK+ AFK++ Sbjct: 72 EDEEEQDKKKKKVIAFKSY 90 >dbj|GAV61348.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 62.8 bits (151), Expect = 6e-10 Identities = 32/78 (41%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T +KE D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIKEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDDEEQDKKKKKVIAFKS 89 >dbj|GAV58829.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDEEEQDKKKKKVIAFKS 89 >dbj|GAV63689.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDEEEQDKKKKKVIAFKS 89 >dbj|GAV70805.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 62.0 bits (149), Expect = 1e-09 Identities = 31/78 (39%), Positives = 44/78 (56%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W +K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWILKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDDEEQDKKKKKVIAFKS 89 >dbj|GAV87116.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 119 Score = 61.6 bits (148), Expect = 2e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 21 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLALEELLGSLMTHEMTIKNH 80 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 81 EDEEEQDKKKKKVIAFKS 98 >dbj|GAV83725.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 172 Score = 62.8 bits (151), Expect = 2e-09 Identities = 32/78 (41%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D F +G+ THEM + Sbjct: 46 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTFPFEELLGSLMTHEMTIKNH 105 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 106 EDDEEQDKKKKKVIAFKS 123 >dbj|GAV81443.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 122 Score = 61.6 bits (148), Expect = 2e-09 Identities = 31/78 (39%), Positives = 44/78 (56%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R PK+W K T ++E D + F +G+ THEM + Sbjct: 21 LQSLNKCYTNSEMVRKILRCQPKSWMPKVTAIEEAKDLNTLPFGELLGSLMTHEMTIKNH 80 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ +AFK+ Sbjct: 81 EDDEEQDKKKKKVSAFKS 98 >dbj|GAV73843.1| UBN2 domain-containing protein [Cephalotus follicularis] Length = 226 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/79 (40%), Positives = 44/79 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 21 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 80 Query: 229 EDRRPQQPKKEVGAAFKAF 173 ED Q KK+ AFK+F Sbjct: 81 EDDEEQDKKKKKVIAFKSF 99 >dbj|GAV58068.1| DUF4219 domain-containing protein/UBN2 domain-containing protein [Cephalotus follicularis] Length = 259 Score = 63.9 bits (154), Expect = 2e-09 Identities = 32/79 (40%), Positives = 43/79 (54%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 150 LQSLNRCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 209 Query: 229 EDRRPQQPKKEVGAAFKAF 173 ED Q KK+ AFK+F Sbjct: 210 EDEEEQDKKKKKVIAFKSF 228 >dbj|GAV65035.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 119 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 21 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 80 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 81 EDDEEQDKKKKKVIAFKS 98 >dbj|GAV58821.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDDEEQDKKKKKVIAFKS 89 >dbj|GAV60936.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNILPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDEEEQDKKKKKVIAFKS 89 >dbj|GAV61938.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/78 (39%), Positives = 44/78 (56%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN++ VRKI+R LPK+W K TT++E D +G+ THEM + Sbjct: 12 LESLNKCYTNNEMVRKILRCLPKSWMPKVTTIEEAKDLNTFPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q +K+ AFK+ Sbjct: 72 EDDEEQDKEKKKVIAFKS 89 >dbj|GAV66317.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 61.2 bits (147), Expect = 2e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDDEEQDKKKKKVIAFKS 89 >dbj|GAV80145.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 158 Score = 62.0 bits (149), Expect = 3e-09 Identities = 31/78 (39%), Positives = 42/78 (53%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 46 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLSLEELLGSLMTHEMTIKNH 105 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK AFK+ Sbjct: 106 EDEEEQDKKKNKVIAFKS 123 >dbj|GAV66244.1| zf-CCHC domain-containing protein/DUF4219 domain-containing protein/UBN2 domain-containing protein [Cephalotus follicularis] Length = 312 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/78 (41%), Positives = 44/78 (56%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+F THEM + Sbjct: 150 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLALEELLGSFMTHEMTIKNH 209 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 210 EDEEEQDKKKKKVIAFKS 227 >dbj|GAV81440.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 119 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 21 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLNTLPLEDLLGSLMTHEMTIKNH 80 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 81 EDDEEQDKKKKKVIAFKS 98 >dbj|GAV83994.1| UBN2 domain-containing protein, partial [Cephalotus follicularis] Length = 120 Score = 60.8 bits (146), Expect = 3e-09 Identities = 31/78 (39%), Positives = 43/78 (55%) Frame = -3 Query: 409 LVSLGEKLTNDQKVRKIIRSLPKAWEVKATTLKELNDAKEMDFTVFMGNFKTHEMEMTAR 230 L SL + TN + VRKI+R LPK+W K T ++E D + +G+ THEM + Sbjct: 12 LQSLNKCYTNSEMVRKILRCLPKSWMPKVTAIEEAKDLITLPLEELLGSLMTHEMTIKNH 71 Query: 229 EDRRPQQPKKEVGAAFKA 176 ED Q KK+ AFK+ Sbjct: 72 EDEEEQDKKKKKVIAFKS 89