BLASTX nr result
ID: Ophiopogon27_contig00029220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029220 (375 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKU87909.1| Pleiotropic drug resistance protein 12 [Dendrobiu... 57 1e-06 ref|XP_020691337.1| ABC transporter G family member 42-like [Den... 57 1e-06 ref|XP_020587665.1| ABC transporter G family member 42-like [Pha... 55 4e-06 gb|ONK80619.1| uncharacterized protein A4U43_C01F19860 [Asparagu... 55 5e-06 ref|XP_020248633.1| LOW QUALITY PROTEIN: ABC transporter G famil... 55 5e-06 >gb|PKU87909.1| Pleiotropic drug resistance protein 12 [Dendrobium catenatum] Length = 1482 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 PVVAIVLVGWSVFFAITFAFCIRTLNFQQR 92 PVVA+VLVG+ VFFA TFAFCIRTLNFQQR Sbjct: 1453 PVVAVVLVGFCVFFAFTFAFCIRTLNFQQR 1482 >ref|XP_020691337.1| ABC transporter G family member 42-like [Dendrobium catenatum] Length = 1508 Score = 56.6 bits (135), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 PVVAIVLVGWSVFFAITFAFCIRTLNFQQR 92 PVVA+VLVG+ VFFA TFAFCIRTLNFQQR Sbjct: 1479 PVVAVVLVGFCVFFAFTFAFCIRTLNFQQR 1508 >ref|XP_020587665.1| ABC transporter G family member 42-like [Phalaenopsis equestris] Length = 1497 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 PVVAIVLVGWSVFFAITFAFCIRTLNFQQR 92 P VA+VLVG+ VFFA TFAFCIRTLNFQQR Sbjct: 1468 PAVAVVLVGFCVFFAFTFAFCIRTLNFQQR 1497 >gb|ONK80619.1| uncharacterized protein A4U43_C01F19860 [Asparagus officinalis] Length = 1333 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 PVVAIVLVGWSVFFAITFAFCIRTLNFQQR 92 PVVA+VLVG+SVFFA FAFCIR LNFQQR Sbjct: 1304 PVVAVVLVGFSVFFAFVFAFCIRALNFQQR 1333 >ref|XP_020248633.1| LOW QUALITY PROTEIN: ABC transporter G family member 42-like [Asparagus officinalis] Length = 1535 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 PVVAIVLVGWSVFFAITFAFCIRTLNFQQR 92 PVVA+VLVG+SVFFA FAFCIR LNFQQR Sbjct: 1506 PVVAVVLVGFSVFFAFVFAFCIRALNFQQR 1535