BLASTX nr result
ID: Ophiopogon27_contig00029120
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029120 (557 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073495412.1| hypothetical protein [Enterococcus faecalis] 54 2e-06 ref|WP_073985089.1| hypothetical protein [Enterococcus faecium] 53 4e-06 ref|WP_073421091.1| hypothetical protein [Enterococcus faecium] 52 5e-06 ref|WP_073994939.1| hypothetical protein [Enterococcus faecium] 52 5e-06 >ref|WP_073495412.1| hypothetical protein [Enterococcus faecalis] Length = 65 Score = 53.5 bits (127), Expect = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -1 Query: 92 LNMIHIIQKFNRSEERRVGKECRSRWSPYH 3 +N+++ ++ NRSEERRVGKECRSRWSPYH Sbjct: 36 VNVMNFLRTINRSEERRVGKECRSRWSPYH 65 >ref|WP_073985089.1| hypothetical protein [Enterococcus faecium] Length = 68 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -1 Query: 107 IQIDILNMIHIIQKFNRSEERRVGKECRSRWSPYH 3 I ++ +I+I +K RSEERRVGKECRSRWSPYH Sbjct: 34 ISASLMCVIYIKRKIPRSEERRVGKECRSRWSPYH 68 >ref|WP_073421091.1| hypothetical protein [Enterococcus faecium] Length = 67 Score = 52.4 bits (124), Expect = 5e-06 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 2/47 (4%) Frame = -1 Query: 137 TALC--ISRFYLIQIDILNMIHIIQKFNRSEERRVGKECRSRWSPYH 3 T C I++ Y I N+ +I+ + RSEERRVGKECRSRWSPYH Sbjct: 21 TVFCTLINQNYKFVISRENIENILSPYLRSEERRVGKECRSRWSPYH 67 >ref|WP_073994939.1| hypothetical protein [Enterococcus faecium] Length = 71 Score = 52.4 bits (124), Expect = 5e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -1 Query: 95 ILNMIHIIQKFNRSEERRVGKECRSRWSPYH 3 IL+ + +I RSEERRVGKECRSRWSPYH Sbjct: 41 ILHPLEVINTLQRSEERRVGKECRSRWSPYH 71