BLASTX nr result
ID: Ophiopogon27_contig00029045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00029045 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381848.1| PREDICTED: U1 small nuclear ribonucleoprotei... 60 2e-07 ref|XP_009381854.1| PREDICTED: U1 small nuclear ribonucleoprotei... 59 6e-07 ref|XP_009383739.1| PREDICTED: U1 small nuclear ribonucleoprotei... 59 6e-07 ref|XP_020273967.1| U1 small nuclear ribonucleoprotein A-like [A... 57 2e-06 ref|XP_009383740.1| PREDICTED: U1 small nuclear ribonucleoprotei... 57 2e-06 gb|OAY81346.1| U1 small nuclear ribonucleoprotein A [Ananas como... 56 3e-06 ref|XP_020113512.1| U1 small nuclear ribonucleoprotein A isoform... 56 7e-06 ref|XP_020113511.1| U1 small nuclear ribonucleoprotein A isoform... 56 7e-06 >ref|XP_009381848.1| PREDICTED: U1 small nuclear ribonucleoprotein A isoform X1 [Musa acuminata subsp. malaccensis] Length = 250 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 615 AERKRRDQHHDVNQAGTGLNSAYPGAYGGVPSVS 514 AERK+R+QHHD NQ GTGLNSAY GAYG VP +S Sbjct: 122 AERKKREQHHDANQGGTGLNSAYSGAYGAVPPLS 155 >ref|XP_009381854.1| PREDICTED: U1 small nuclear ribonucleoprotein A isoform X2 [Musa acuminata subsp. malaccensis] Length = 249 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 612 ERKRRDQHHDVNQAGTGLNSAYPGAYGGVPSVS 514 ERK+R+QHHD NQ GTGLNSAY GAYG VP +S Sbjct: 122 ERKKREQHHDANQGGTGLNSAYSGAYGAVPPLS 154 >ref|XP_009383739.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 250 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 615 AERKRRDQHHDVNQAGTGLNSAYPGAYGGVPSVS 514 A+RK+R+QHHD NQAGTG+NSAY GAYG VP ++ Sbjct: 122 ADRKKREQHHDANQAGTGINSAYSGAYGAVPPLA 155 >ref|XP_020273967.1| U1 small nuclear ribonucleoprotein A-like [Asparagus officinalis] gb|ONK63336.1| uncharacterized protein A4U43_C07F14000 [Asparagus officinalis] Length = 248 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 615 AERKRRDQHHDVNQAGTGLNSAYPGAYGGVPSVS 514 AERKR+DQHHD NQA GLN AY GAYG VP +S Sbjct: 120 AERKRKDQHHDANQAAMGLNPAYAGAYGAVPQLS 153 >ref|XP_009383740.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 249 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 612 ERKRRDQHHDVNQAGTGLNSAYPGAYGGVPSVS 514 +RK+R+QHHD NQAGTG+NSAY GAYG VP ++ Sbjct: 122 DRKKREQHHDANQAGTGINSAYSGAYGAVPPLA 154 >gb|OAY81346.1| U1 small nuclear ribonucleoprotein A [Ananas comosus] Length = 170 Score = 55.8 bits (133), Expect = 3e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 615 AERKRRDQHHDVNQAGTGLNSAYPGAYGGVP 523 AERKRR+QHHD NQ G GLNS+YPG YG P Sbjct: 43 AERKRREQHHDANQVGLGLNSSYPGVYGAPP 73 >ref|XP_020113512.1| U1 small nuclear ribonucleoprotein A isoform X2 [Ananas comosus] Length = 242 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 615 AERKRRDQHHDVNQAGTGLNSAYPGAYGGVP 523 AERKRR+QHHD NQ G GLNS+YPG YG P Sbjct: 118 AERKRREQHHDANQVGLGLNSSYPGVYGAPP 148 >ref|XP_020113511.1| U1 small nuclear ribonucleoprotein A isoform X1 [Ananas comosus] gb|OAY81358.1| U1 small nuclear ribonucleoprotein A [Ananas comosus] Length = 245 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -1 Query: 615 AERKRRDQHHDVNQAGTGLNSAYPGAYGGVP 523 AERKRR+QHHD NQ G GLNS+YPG YG P Sbjct: 118 AERKRREQHHDANQVGLGLNSSYPGVYGAPP 148