BLASTX nr result
ID: Ophiopogon27_contig00028901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00028901 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259463.1| uncharacterized protein LOC109835896 [Aspara... 69 2e-11 >ref|XP_020259463.1| uncharacterized protein LOC109835896 [Asparagus officinalis] Length = 124 Score = 68.6 bits (166), Expect = 2e-11 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 16/101 (15%) Frame = -3 Query: 406 TLVAIVADAHPTCNPKACDPGSSLGANILTI----------------QLLSPDMLGISTC 275 T A A A+P CNP +PGS L AN+ T+ + P + G S C Sbjct: 21 TAAAASASANPRCNPTTYEPGSDLEANVFTVLESIRTATASTPDRTYTIQLPHVFGASMC 80 Query: 274 HTDIAVENCFSCLNNSIDEIKEKSIGSITASYAHGGCSVFH 152 +DI V +C SC+N+S+D +K++ SI A+ + G C +F+ Sbjct: 81 ISDIDVGDCISCINDSVDAVKDQCDRSIAATISAGDCGMFY 121