BLASTX nr result
ID: Ophiopogon27_contig00028658
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00028658 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OEL31347.1| Ubiquitin-conjugating enzyme E2 36 [Dichanthelium... 72 4e-13 gb|OAY63083.1| Ubiquitin-conjugating enzyme E2 36, partial [Anan... 69 1e-12 ref|XP_008793013.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 2e-12 gb|PKU86171.1| Ubiquitin-conjugating enzyme E2 36 [Dendrobium ca... 67 2e-12 gb|EMS46318.1| Ubiquitin-conjugating enzyme E2 36 [Triticum urartu] 70 2e-12 gb|OAY76100.1| Ubiquitin-conjugating enzyme E2 36 [Ananas comosus] 69 2e-12 gb|KHG21556.1| Ubiquitin-conjugating enzyme E2 35 -like protein ... 70 2e-12 gb|ONK79239.1| uncharacterized protein A4U43_C01F4340 [Asparagus... 69 2e-12 ref|XP_020106224.1| ubiquitin-conjugating enzyme E2 36-like isof... 69 2e-12 gb|OEL19317.1| Ubiquitin-conjugating enzyme E2 36 [Dichanthelium... 72 2e-12 gb|EEC71254.1| hypothetical protein OsI_03230 [Oryza sativa Indi... 69 3e-12 gb|OVA04047.1| Ubiquitin-conjugating enzyme [Macleaya cordata] 69 3e-12 gb|ACG35943.1| hypothetical protein [Zea mays] 67 3e-12 gb|ACF79940.1| unknown [Zea mays] >gi|1142839151|gb|AQK97237.1| ... 67 3e-12 ref|XP_019707141.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 68 3e-12 ref|XP_020273255.1| ubiquitin-conjugating enzyme E2 36 [Asparagu... 69 3e-12 ref|XP_020106223.1| ubiquitin-conjugating enzyme E2 36-like isof... 69 3e-12 ref|XP_020098226.1| ubiquitin-conjugating enzyme E2 36 [Ananas c... 69 3e-12 ref|XP_004969503.1| ubiquitin-conjugating enzyme E2 36 [Setaria ... 69 3e-12 ref|XP_008793012.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 69 3e-12 >gb|OEL31347.1| Ubiquitin-conjugating enzyme E2 36 [Dichanthelium oligosanthes] Length = 168 Score = 71.6 bits (174), Expect = 4e-13 Identities = 40/72 (55%), Positives = 46/72 (63%) Frame = -1 Query: 248 GHYILNSLNLCTAPGMQFSKFQLAWKTRCSNKGSYVSVSVIQALLSAPNPDDPLSDNIAK 69 G L+ L +P +Q L+ C Y+ S IQALLSAPNPDDPLSDN+AK Sbjct: 86 GRICLDILKDKWSPALQIRTVLLSVLPYCLLSPDYLIFS-IQALLSAPNPDDPLSDNVAK 144 Query: 68 HWKANEAEAVET 33 HWKANEAEAVET Sbjct: 145 HWKANEAEAVET 156 >gb|OAY63083.1| Ubiquitin-conjugating enzyme E2 36, partial [Ananas comosus] Length = 115 Score = 68.9 bits (167), Expect = 1e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 41 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 72 >ref|XP_008793013.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform X2 [Phoenix dactylifera] Length = 120 Score = 68.9 bits (167), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 77 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 108 >gb|PKU86171.1| Ubiquitin-conjugating enzyme E2 36 [Dendrobium catenatum] Length = 71 Score = 67.4 bits (163), Expect = 2e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWK NEAEAVET Sbjct: 28 IQALLSAPNPDDPLSDNIAKHWKTNEAEAVET 59 >gb|EMS46318.1| Ubiquitin-conjugating enzyme E2 36 [Triticum urartu] Length = 175 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVETDDD 24 IQALLSAPNPDDPL+DN+AKHWKANE EAVET DD Sbjct: 110 IQALLSAPNPDDPLADNVAKHWKANETEAVETGDD 144 >gb|OAY76100.1| Ubiquitin-conjugating enzyme E2 36 [Ananas comosus] Length = 128 Score = 68.9 bits (167), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 85 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 116 >gb|KHG21556.1| Ubiquitin-conjugating enzyme E2 35 -like protein [Gossypium arboreum] Length = 170 Score = 69.7 bits (169), Expect = 2e-12 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -1 Query: 248 GHYILNSLNLCTAPGMQFSKFQLA---WKTRCSNKGSYVSVSVIQALLSAPNPDDPLSDN 78 G L+ L +P +Q L WK + + ++V+ IQALLSAPNPDDPLS+N Sbjct: 87 GRICLDILKDKWSPALQIRTVLLRYCKWKRKLNVS---IAVAYIQALLSAPNPDDPLSEN 143 Query: 77 IAKHWKANEAEAVET 33 IAKHWK+NEAEAVET Sbjct: 144 IAKHWKSNEAEAVET 158 >gb|ONK79239.1| uncharacterized protein A4U43_C01F4340 [Asparagus officinalis] Length = 139 Score = 68.9 bits (167), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 96 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 127 >ref|XP_020106224.1| ubiquitin-conjugating enzyme E2 36-like isoform X2 [Ananas comosus] gb|OAY74482.1| Ubiquitin-conjugating enzyme E2 36 [Ananas comosus] Length = 139 Score = 68.9 bits (167), Expect = 2e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 96 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 127 >gb|OEL19317.1| Ubiquitin-conjugating enzyme E2 36 [Dichanthelium oligosanthes] Length = 444 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVETDDDG 21 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET ++G Sbjct: 110 IQALLSAPNPDDPLSDNIAKHWKANEAEAVETGEEG 145 >gb|EEC71254.1| hypothetical protein OsI_03230 [Oryza sativa Indica Group] Length = 142 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 99 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 130 >gb|OVA04047.1| Ubiquitin-conjugating enzyme [Macleaya cordata] Length = 144 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 101 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 132 >gb|ACG35943.1| hypothetical protein [Zea mays] Length = 88 Score = 67.4 bits (163), Expect = 3e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANE EAVET Sbjct: 45 IQALLSAPNPDDPLSDNIAKHWKANEVEAVET 76 >gb|ACF79940.1| unknown [Zea mays] gb|AQK97237.1| Putative ubiquitin-conjugating enzyme family [Zea mays] Length = 88 Score = 67.4 bits (163), Expect = 3e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANE EAVET Sbjct: 45 IQALLSAPNPDDPLSDNIAKHWKANEVEAVET 76 >ref|XP_019707141.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Elaeis guineensis] Length = 103 Score = 67.8 bits (164), Expect = 3e-12 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVETDDD 24 IQALLSAPNPDDPLSDNIAKHWKANEAEAVE D Sbjct: 60 IQALLSAPNPDDPLSDNIAKHWKANEAEAVEKAKD 94 >ref|XP_020273255.1| ubiquitin-conjugating enzyme E2 36 [Asparagus officinalis] Length = 153 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 110 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 141 >ref|XP_020106223.1| ubiquitin-conjugating enzyme E2 36-like isoform X1 [Ananas comosus] Length = 153 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 110 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 141 >ref|XP_020098226.1| ubiquitin-conjugating enzyme E2 36 [Ananas comosus] Length = 153 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 110 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 141 >ref|XP_004969503.1| ubiquitin-conjugating enzyme E2 36 [Setaria italica] ref|XP_006644506.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Oryza brachyantha] ref|XP_015621872.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Oryza sativa Japonica Group] dbj|BAB84382.1| putative ubiquitin-conjugating enzyme E2 [Oryza sativa Japonica Group] dbj|BAC01179.1| putative ubiquitin-conjugating enzyme E2 [Oryza sativa Japonica Group] dbj|BAF05748.1| Os01g0673600 [Oryza sativa Japonica Group] dbj|BAH00779.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEE55162.1| hypothetical protein OsJ_02975 [Oryza sativa Japonica Group] gb|AEK99337.1| ubiquitin conjugated enzyme [Oryza sativa Japonica Group] dbj|BAS73632.1| Os01g0673600 [Oryza sativa Japonica Group] gb|KQL06363.1| hypothetical protein SETIT_003217mg [Setaria italica] gb|PAN18160.1| hypothetical protein PAHAL_C01970 [Panicum hallii] Length = 153 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 110 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 141 >ref|XP_008793012.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform X1 [Phoenix dactylifera] Length = 153 Score = 68.9 bits (167), Expect = 3e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 128 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 33 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET Sbjct: 110 IQALLSAPNPDDPLSDNIAKHWKANEAEAVET 141