BLASTX nr result
ID: Ophiopogon27_contig00028462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00028462 (774 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261892.1| K(+) efflux antiporter 5-like isoform X2 [As... 61 5e-07 ref|XP_020261891.1| K(+) efflux antiporter 5-like isoform X1 [As... 61 5e-07 >ref|XP_020261892.1| K(+) efflux antiporter 5-like isoform X2 [Asparagus officinalis] Length = 455 Score = 61.2 bits (147), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 620 LMHLGSLMRWFPAESSTQIEEKGAMLEIHTRAL 522 +MHLGSLMRWFPAESST +EEKGAML++H R L Sbjct: 423 IMHLGSLMRWFPAESSTPVEEKGAMLDVHNRVL 455 >ref|XP_020261891.1| K(+) efflux antiporter 5-like isoform X1 [Asparagus officinalis] gb|ONK73030.1| uncharacterized protein A4U43_C04F26370 [Asparagus officinalis] Length = 569 Score = 61.2 bits (147), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 620 LMHLGSLMRWFPAESSTQIEEKGAMLEIHTRAL 522 +MHLGSLMRWFPAESST +EEKGAML++H R L Sbjct: 537 IMHLGSLMRWFPAESSTPVEEKGAMLDVHNRVL 569