BLASTX nr result
ID: Ophiopogon27_contig00028308
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00028308 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270438.1| phosphatidylinositol/phosphatidylcholine tra... 63 1e-08 ref|XP_020270437.1| phosphatidylinositol/phosphatidylcholine tra... 63 1e-08 ref|XP_020270436.1| phosphatidylinositol/phosphatidylcholine tra... 63 1e-08 ref|XP_020270435.1| phosphatidylinositol/phosphatidylcholine tra... 63 1e-08 ref|XP_020251529.1| phosphatidylinositol/phosphatidylcholine tra... 60 1e-07 ref|XP_020251528.1| phosphatidylinositol/phosphatidylcholine tra... 60 1e-07 ref|XP_020251527.1| phosphatidylinositol/phosphatidylcholine tra... 60 1e-07 ref|XP_020251526.1| phosphatidylinositol/phosphatidylcholine tra... 60 1e-07 >ref|XP_020270438.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X4 [Asparagus officinalis] ref|XP_020270439.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X4 [Asparagus officinalis] ref|XP_020270440.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X4 [Asparagus officinalis] Length = 597 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVEXXXXXKRGF 338 TSRVDKLE+ELQ+TKKALQDALTRQEELLAYVE KR F Sbjct: 548 TSRVDKLESELQSTKKALQDALTRQEELLAYVEKKKKKKRRF 589 >ref|XP_020270437.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X3 [Asparagus officinalis] gb|ONK66255.1| uncharacterized protein A4U43_C06F5820 [Asparagus officinalis] Length = 671 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVEXXXXXKRGF 338 TSRVDKLE+ELQ+TKKALQDALTRQEELLAYVE KR F Sbjct: 622 TSRVDKLESELQSTKKALQDALTRQEELLAYVEKKKKKKRRF 663 >ref|XP_020270436.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X2 [Asparagus officinalis] Length = 672 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVEXXXXXKRGF 338 TSRVDKLE+ELQ+TKKALQDALTRQEELLAYVE KR F Sbjct: 623 TSRVDKLESELQSTKKALQDALTRQEELLAYVEKKKKKKRRF 664 >ref|XP_020270435.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X1 [Asparagus officinalis] Length = 673 Score = 63.2 bits (152), Expect = 1e-08 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVEXXXXXKRGF 338 TSRVDKLE+ELQ+TKKALQDALTRQEELLAYVE KR F Sbjct: 624 TSRVDKLESELQSTKKALQDALTRQEELLAYVEKKKKKKRRF 665 >ref|XP_020251529.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X4 [Asparagus officinalis] gb|ONK81266.1| uncharacterized protein A4U43_C01F27180 [Asparagus officinalis] Length = 544 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVE 365 TSRVDKLETELQATKKAL+D+L RQEELLAYVE Sbjct: 501 TSRVDKLETELQATKKALEDSLKRQEELLAYVE 533 >ref|XP_020251528.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X3 [Asparagus officinalis] Length = 550 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVE 365 TSRVDKLETELQATKKAL+D+L RQEELLAYVE Sbjct: 498 TSRVDKLETELQATKKALEDSLKRQEELLAYVE 530 >ref|XP_020251527.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X2 [Asparagus officinalis] Length = 552 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVE 365 TSRVDKLETELQATKKAL+D+L RQEELLAYVE Sbjct: 500 TSRVDKLETELQATKKALEDSLKRQEELLAYVE 532 >ref|XP_020251526.1| phosphatidylinositol/phosphatidylcholine transfer protein SFH12-like isoform X1 [Asparagus officinalis] Length = 553 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 463 TSRVDKLETELQATKKALQDALTRQEELLAYVE 365 TSRVDKLETELQATKKAL+D+L RQEELLAYVE Sbjct: 501 TSRVDKLETELQATKKALEDSLKRQEELLAYVE 533