BLASTX nr result
ID: Ophiopogon27_contig00028266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00028266 (692 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268027.1| aldo-keto reductase family 4 member C9-like ... 59 1e-06 >ref|XP_020268027.1| aldo-keto reductase family 4 member C9-like [Asparagus officinalis] Length = 320 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 380 VMQARLLRGDFAVNETESPYKTVEELWDGEI 288 + QARLLRG+FAVNET+SPY++VEELWDGEI Sbjct: 290 IQQARLLRGEFAVNETDSPYRSVEELWDGEI 320