BLASTX nr result
ID: Ophiopogon27_contig00028026
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00028026 (380 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266382.1| uncharacterized protein LOC109841860 [Aspara... 56 2e-06 gb|ONK82025.1| uncharacterized protein A4U43_C01F35360 [Asparagu... 56 2e-06 >ref|XP_020266382.1| uncharacterized protein LOC109841860 [Asparagus officinalis] Length = 1122 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 258 VK*VRVVPWGKWFPATSFQRDLYLYVGAEYVREVATIVKSH 380 VK VR+VPW + ATS QRDLYL +GAEYV+ V TI+KSH Sbjct: 342 VKRVRMVPWRRRLRATSSQRDLYLQMGAEYVKHVTTIMKSH 382 >gb|ONK82025.1| uncharacterized protein A4U43_C01F35360 [Asparagus officinalis] Length = 1434 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 258 VK*VRVVPWGKWFPATSFQRDLYLYVGAEYVREVATIVKSH 380 VK VR+VPW + ATS QRDLYL +GAEYV+ V TI+KSH Sbjct: 342 VKRVRMVPWRRRLRATSSQRDLYLQMGAEYVKHVTTIMKSH 382