BLASTX nr result
ID: Ophiopogon27_contig00027986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00027986 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241386.1| WRKY transcription factor SUSIBA2-like [Aspa... 73 3e-12 >ref|XP_020241386.1| WRKY transcription factor SUSIBA2-like [Asparagus officinalis] gb|ONK59794.1| uncharacterized protein A4U43_C08F10760 [Asparagus officinalis] Length = 541 Score = 72.8 bits (177), Expect = 3e-12 Identities = 34/60 (56%), Positives = 39/60 (65%) Frame = -3 Query: 353 SDGNRALAQETPLXXXXXXXXXXXXXSKDANAEGFSFRTPPVNHSSEHYHPNSGNLVMGP 174 +DGN + Q PL S++ NAEGFSFR P VNHSSEHY+PNSGNLVMGP Sbjct: 482 TDGNNLMVQRAPLSVVYGSSGNGLYGSREGNAEGFSFRAPSVNHSSEHYYPNSGNLVMGP 541