BLASTX nr result
ID: Ophiopogon27_contig00027923
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00027923 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK77375.1| uncharacterized protein A4U43_C02F5870 [Asparagus... 59 4e-07 ref|XP_020253770.1| zinc finger CCCH domain-containing protein 1... 59 4e-07 >gb|ONK77375.1| uncharacterized protein A4U43_C02F5870 [Asparagus officinalis] Length = 700 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -1 Query: 457 SVREEIDGHVVKGRSSSHREASKSYEKLKHYREKRKHEVNNSDSDEMYDRRARNKFSRKQ 278 S REE + G SSSHR+ SKS KLKH R+KR+H N+S SDE DR+ R K S Q Sbjct: 626 SGREETEESSYNGSSSSHRKPSKSGGKLKHCRKKRRHVDNSSGSDEELDRKPRKKHSHGQ 685 Query: 277 AST 269 ++ Sbjct: 686 RTS 688 >ref|XP_020253770.1| zinc finger CCCH domain-containing protein 16 [Asparagus officinalis] Length = 725 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/63 (50%), Positives = 40/63 (63%) Frame = -1 Query: 457 SVREEIDGHVVKGRSSSHREASKSYEKLKHYREKRKHEVNNSDSDEMYDRRARNKFSRKQ 278 S REE + G SSSHR+ SKS KLKH R+KR+H N+S SDE DR+ R K S Q Sbjct: 651 SGREETEESSYNGSSSSHRKPSKSGGKLKHCRKKRRHVDNSSGSDEELDRKPRKKHSHGQ 710 Query: 277 AST 269 ++ Sbjct: 711 RTS 713