BLASTX nr result
ID: Ophiopogon27_contig00027613
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00027613 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008780351.1| PREDICTED: uncharacterized protein LOC103700... 55 2e-06 >ref|XP_008780351.1| PREDICTED: uncharacterized protein LOC103700167 [Phoenix dactylifera] Length = 144 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/45 (60%), Positives = 29/45 (64%) Frame = +2 Query: 206 GWSGRENGPGLQGFSFSFDTRISAPIDTTPKFGSFNLSLDLAGLE 340 G G G GFSFSFDTR API+TTPKFGSFN S DL + Sbjct: 74 GEDEESRGSGRGGFSFSFDTRGIAPIETTPKFGSFNCSADLGAAQ 118