BLASTX nr result
ID: Ophiopogon27_contig00027311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00027311 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020271646.1| uncharacterized protein LOC109846812 [Aspara... 61 4e-08 >ref|XP_020271646.1| uncharacterized protein LOC109846812 [Asparagus officinalis] Length = 275 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 351 DLFRKQADKYAGTRPTYPSELFQFIASKIPNH 446 +LFRKQADKYA TRPTYP ELF+FIASK PNH Sbjct: 3 ELFRKQADKYAQTRPTYPPELFEFIASKTPNH 34