BLASTX nr result
ID: Ophiopogon27_contig00027300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00027300 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNT62294.1| hypothetical protein BRADI_4g01207v3 [Brachypodiu... 64 1e-10 >gb|PNT62294.1| hypothetical protein BRADI_4g01207v3 [Brachypodium distachyon] Length = 76 Score = 63.9 bits (154), Expect = 1e-10 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -1 Query: 287 SSYYYDMLFFPSITFQDQSRFYRLYQ*SGRIGCFIQMCKRS 165 + +YYDMLFFP IT +DQS RLYQ SGRI CFIQMCKRS Sbjct: 36 NEFYYDMLFFPFITLEDQSWSSRLYQESGRICCFIQMCKRS 76