BLASTX nr result
ID: Ophiopogon27_contig00027140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00027140 (1459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014617974.1| PREDICTED: lysine-specific demethylase JMJ70... 57 1e-06 >ref|XP_014617974.1| PREDICTED: lysine-specific demethylase JMJ706-like [Glycine max] Length = 83 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 1273 IVGSNRSMLYIGMLFSMFAWHVEDHYLYKYI 1365 I G MLYIGMLFSMFAWHVEDHYLY+YI Sbjct: 53 IPGITDPMLYIGMLFSMFAWHVEDHYLYRYI 83