BLASTX nr result
ID: Ophiopogon27_contig00026793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00026793 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018846272.1| PREDICTED: uncharacterized protein LOC109010... 56 1e-07 gb|PIA60483.1| hypothetical protein AQUCO_00300170v1 [Aquilegia ... 55 1e-07 ref|XP_023912523.1| uncharacterized protein LOC112024113 [Quercu... 54 4e-07 ref|XP_002308177.1| hypothetical protein POPTR_0006s09110g [Popu... 54 6e-07 ref|XP_022842086.1| uncharacterized protein LOC111365800 [Olea e... 54 6e-07 gb|PON90812.1| hypothetical protein TorRG33x02_134500 [Trema ori... 54 7e-07 gb|ONK76892.1| uncharacterized protein A4U43_C02F930 [Asparagus ... 54 7e-07 ref|XP_011006398.1| PREDICTED: uncharacterized protein LOC105112... 54 9e-07 ref|XP_006429167.1| uncharacterized protein LOC18038001 [Citrus ... 52 2e-06 gb|PON33023.1| hypothetical protein PanWU01x14_356300 [Parasponi... 52 3e-06 gb|PRQ43151.1| hypothetical protein RchiOBHm_Chr3g0465351 [Rosa ... 52 3e-06 >ref|XP_018846272.1| PREDICTED: uncharacterized protein LOC109010024 [Juglans regia] Length = 97 Score = 55.8 bits (133), Expect = 1e-07 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTSEMNKYLSS 109 G+WFN+SPSASY+RLPGDSGRF+TS++ + SS Sbjct: 24 GSWFNDSPSASYMRLPGDSGRFQTSDVQLFCSS 56 >gb|PIA60483.1| hypothetical protein AQUCO_00300170v1 [Aquilegia coerulea] Length = 97 Score = 55.5 bits (132), Expect = 1e-07 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTSEMN 94 G+WFNESPSASY+RLPGDSGRF++SEM+ Sbjct: 25 GSWFNESPSASYMRLPGDSGRFQSSEMH 52 >ref|XP_023912523.1| uncharacterized protein LOC112024113 [Quercus suber] gb|POF10355.1| hypothetical protein CFP56_46219 [Quercus suber] Length = 98 Score = 54.3 bits (129), Expect = 4e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTSEMNKY 100 G+WFNESPSASY+RLPGDSGRF+TS++ + Sbjct: 26 GSWFNESPSASYMRLPGDSGRFQTSDVQLF 55 >ref|XP_002308177.1| hypothetical protein POPTR_0006s09110g [Populus trichocarpa] gb|PNT30606.1| hypothetical protein POPTR_006G090100v3 [Populus trichocarpa] Length = 100 Score = 53.9 bits (128), Expect = 6e-07 Identities = 22/27 (81%), Positives = 27/27 (100%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTSEM 91 G+WFNESPSASY+RLPGDSGRF+TS++ Sbjct: 25 GSWFNESPSASYMRLPGDSGRFQTSDI 51 >ref|XP_022842086.1| uncharacterized protein LOC111365800 [Olea europaea var. sylvestris] Length = 85 Score = 53.5 bits (127), Expect = 6e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTSEM 91 GAW NESPSASY+RLPGDSGRF+TS++ Sbjct: 24 GAWLNESPSASYVRLPGDSGRFQTSDI 50 >gb|PON90812.1| hypothetical protein TorRG33x02_134500 [Trema orientalis] Length = 105 Score = 53.9 bits (128), Expect = 7e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTS 85 G+WFNESPSASYIRLPGDSGRF+TS Sbjct: 26 GSWFNESPSASYIRLPGDSGRFQTS 50 >gb|ONK76892.1| uncharacterized protein A4U43_C02F930 [Asparagus officinalis] Length = 90 Score = 53.5 bits (127), Expect = 7e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 8 GGAWFNESPSASYIRLPGDSGRFRTSEMNK 97 GG WFNESP ASYIRLPG SGRFR SE+ + Sbjct: 24 GGTWFNESPPASYIRLPGGSGRFRASEIRQ 53 >ref|XP_011006398.1| PREDICTED: uncharacterized protein LOC105112400 [Populus euphratica] Length = 100 Score = 53.5 bits (127), Expect = 9e-07 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRTSE 88 G+WFNESPSASY+RLPGDSGRF+TS+ Sbjct: 25 GSWFNESPSASYMRLPGDSGRFQTSD 50 >ref|XP_006429167.1| uncharacterized protein LOC18038001 [Citrus clementina] ref|XP_006493571.1| PREDICTED: uncharacterized protein LOC102615992 [Citrus sinensis] gb|ESR42407.1| hypothetical protein CICLE_v10013212mg [Citrus clementina] gb|KDO48147.1| hypothetical protein CISIN_1g034581mg [Citrus sinensis] dbj|GAY49742.1| hypothetical protein CUMW_121420 [Citrus unshiu] Length = 90 Score = 52.4 bits (124), Expect = 2e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = +2 Query: 2 LGGGAWFNESPSASYIRLPGDSGRFRTSEM 91 +G G+W+ ESPSASY+RLPGDSGRF+TS++ Sbjct: 21 VGFGSWYGESPSASYMRLPGDSGRFQTSDL 50 >gb|PON33023.1| hypothetical protein PanWU01x14_356300 [Parasponia andersonii] Length = 105 Score = 52.4 bits (124), Expect = 3e-06 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +2 Query: 11 GAWFNESPSASYIRLPGDSGRFRT 82 G+WFNESPSASYIRLPGDSGRF+T Sbjct: 26 GSWFNESPSASYIRLPGDSGRFQT 49 >gb|PRQ43151.1| hypothetical protein RchiOBHm_Chr3g0465351 [Rosa chinensis] Length = 93 Score = 52.0 bits (123), Expect = 3e-06 Identities = 20/31 (64%), Positives = 29/31 (93%) Frame = +2 Query: 14 AWFNESPSASYIRLPGDSGRFRTSEMNKYLS 106 +WF+ESPSA+YIRLPGDSGRF+ S++ +++S Sbjct: 30 SWFSESPSAAYIRLPGDSGRFQNSDIQRFMS 60